(data stored in ACNUC7421 zone)

EMBL: CP001349.PE109

CP001349.PE109       Location/Qualifiers
FT   CDS             120329..121264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0114"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55161"
FT                   /db_xref="InterPro:IPR025430"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUB6"
FT                   /inference="similar to AA sequence:KEGG:M446_4750"
FT                   /protein_id="ACL55161.1"
FT                   /translation="MRPNQNRRMRGRNRNKGPNPLTRAYESNGPDVKIRGTAQHIAEKY
FT                   AQLARDAQANGDPVMAENYFQHGEHYQRIIAAANEQYRQQFGGFRPSFEEDEEGEDEAP
FT                   QTNGYAAGPENRGGNGYTPNGYGQAEDYVDPSQQPQPYETRGERDDRPARFDRQQDRRD
FT                   RFQNRDRPQRQDRQQDRQQDRPERQGEPRQDFRGEQPRQDGYREGGGRGEFRRERPERP
FT                   RREESRPELPAAEEPGLPAFLTNPVRPAPAPAPVPAPVEEHAPVAPPAEAAEPPARPRR
FT                   RRRTRYETQEGAEGGSDLFPPKAPADTPSE"
     MRPNQNRRMR GRNRNKGPNP LTRAYESNGP DVKIRGTAQH IAEKYAQLAR DAQANGDPVM        60
     AENYFQHGEH YQRIIAAANE QYRQQFGGFR PSFEEDEEGE DEAPQTNGYA AGPENRGGNG       120
     YTPNGYGQAE DYVDPSQQPQ PYETRGERDD RPARFDRQQD RRDRFQNRDR PQRQDRQQDR       180
     QQDRPERQGE PRQDFRGEQP RQDGYREGGG RGEFRRERPE RPRREESRPE LPAAEEPGLP       240
     AFLTNPVRPA PAPAPVPAPV EEHAPVAPPA EAAEPPARPR RRRRTRYETQ EGAEGGSDLF       300
     PPKAPADTPS E                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page