(data stored in ACNUC7421 zone)

EMBL: CP001349.PE11

CP001349.PE11        Location/Qualifiers
FT   CDS             13608..14507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0012"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   met:M446_0008 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55063"
FT                   /db_xref="GOA:B8IT01"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT01"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ACL55063.1"
FT                   /translation="MRDVIIVGGGPAGLSAALVLARCRRTVLLIDAGHPRNAVTARMNG
FT                   YLGHDGCPPGELRATARAELARYPSVECRDGEATDARREEDGFTVVLADGRTERARRLI
FT                   LATGLATELPPVEGFAEFWGHGVHHCPYCDGYENRDAPVVVYGRGGSGKGLALELTSWT
FT                   RDLVLCTDGPAEELSASDRDRLARQRIRIDERPVARLEGEDGRPVRLRFADGDALPCRA
FT                   LFFAPAACAPSPLVERIGCDLTPKGTVPTRDYEQSNVPGLYVAGDASRRVQFAIVAAAE
FT                   GAMAAFAINTELLQEDTR"
     MRDVIIVGGG PAGLSAALVL ARCRRTVLLI DAGHPRNAVT ARMNGYLGHD GCPPGELRAT        60
     ARAELARYPS VECRDGEATD ARREEDGFTV VLADGRTERA RRLILATGLA TELPPVEGFA       120
     EFWGHGVHHC PYCDGYENRD APVVVYGRGG SGKGLALELT SWTRDLVLCT DGPAEELSAS       180
     DRDRLARQRI RIDERPVARL EGEDGRPVRL RFADGDALPC RALFFAPAAC APSPLVERIG       240
     CDLTPKGTVP TRDYEQSNVP GLYVAGDASR RVQFAIVAAA EGAMAAFAIN TELLQEDTR        299
//

If you have problems or comments...

PBIL Back to PBIL home page