(data stored in ACNUC7421 zone)

EMBL: CP001349.PE110

CP001349.PE110       Location/Qualifiers
FT   CDS             121317..122450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0115"
FT                   /product="FAD dependent oxidoreductase"
FT                   /EC_number="1.5.3.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   met:M446_4751 sarcosine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55162"
FT                   /db_xref="GOA:B8IUB7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUB7"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACL55162.1"
FT                   /translation="MSQVFDVIVLGVGGMGSATCWHLARRGQRVLGLERFDIPHAMGSS
FT                   HGVNRIIRLAYFEHPSYVPLLRRAYANWREAEVLFGEPLLFITGSVDAGPAQSRVVAGA
FT                   VDACRLHDLPHELLPARELNARFPGYALPEGHLALLQPEGGFVASERAIVAHVALAQGA
FT                   GAEIRARERALGWEPTAAGGVRVRTERGTYEAGRLVLAAGAWMQDFVPALAGRAVPERQ
FT                   VLGWFQPTQPAAFALGRFPVFNALFDEGHFYGFPVWGLPGFKIGLYHHLRETGPAETID
FT                   REVHPRDEALLRQALRRYFPQADGPTMALRTCLFTNTPDEHFVLDTLPDLSQVVVASPC
FT                   SGHGYKFCSVIGEILADLATTGETRFDIGLHGLARLG"
     MSQVFDVIVL GVGGMGSATC WHLARRGQRV LGLERFDIPH AMGSSHGVNR IIRLAYFEHP        60
     SYVPLLRRAY ANWREAEVLF GEPLLFITGS VDAGPAQSRV VAGAVDACRL HDLPHELLPA       120
     RELNARFPGY ALPEGHLALL QPEGGFVASE RAIVAHVALA QGAGAEIRAR ERALGWEPTA       180
     AGGVRVRTER GTYEAGRLVL AAGAWMQDFV PALAGRAVPE RQVLGWFQPT QPAAFALGRF       240
     PVFNALFDEG HFYGFPVWGL PGFKIGLYHH LRETGPAETI DREVHPRDEA LLRQALRRYF       300
     PQADGPTMAL RTCLFTNTPD EHFVLDTLPD LSQVVVASPC SGHGYKFCSV IGEILADLAT       360
     TGETRFDIGL HGLARLG                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page