(data stored in ACNUC7421 zone)

EMBL: CP001349.PE111

CP001349.PE111       Location/Qualifiers
FT   CDS             122557..123213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0116"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sme:SMb20033
FT                   hypothetical transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55163"
FT                   /db_xref="GOA:B8IUB8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUB8"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACL55163.1"
FT                   /translation="MAGSSRAERAEGMRGHDPERTKADIVTVATEEFAENGLSGARVDA
FT                   IAERTRTSKRMIYYYFGSKEGLYLAVLERAYAEIRALEAGLDLERCDPVEGLRRLIGQT
FT                   FDSDEAHAAFIRLVTIENIHKAKHLAGMESIRQINRRVIALIDDLLARGRADGRFRTDV
FT                   DAVDVHMMISALCFFRVANRHTFGAIFDVDLFAPERRAKHRQLIADAVVRALAPT"
     MAGSSRAERA EGMRGHDPER TKADIVTVAT EEFAENGLSG ARVDAIAERT RTSKRMIYYY        60
     FGSKEGLYLA VLERAYAEIR ALEAGLDLER CDPVEGLRRL IGQTFDSDEA HAAFIRLVTI       120
     ENIHKAKHLA GMESIRQINR RVIALIDDLL ARGRADGRFR TDVDAVDVHM MISALCFFRV       180
     ANRHTFGAIF DVDLFAPERR AKHRQLIADA VVRALAPT                               218
//

If you have problems or comments...

PBIL Back to PBIL home page