(data stored in ACNUC7421 zone)

EMBL: CP001349.PE112

CP001349.PE112       Location/Qualifiers
FT   CDS             complement(123605..124939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0117"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: sma:SAV1779
FT                   3-(2-hydroxyphenyl) propionic acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55164"
FT                   /db_xref="GOA:B8IUB9"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUB9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL55164.1"
FT                   /translation="MSVHAVEAGAIAPAIPPAATAAPRKAALASWIGSAVEYYDFFIYG
FT                   AAASLIFPKLFFSPDNPQAALMLSFATFGVAYIARPFGAIGLGHIGDRFGRKRVLTFTL
FT                   LLMGFSTFIIGCLPTYAQAGLLAPTLLVLARFMQGISAAGEQAGANSMTLEHAPADQRA
FT                   FFTSFTLSGTQAGLILANLVFLPITALPEEQLLSWGWRIPFFLSALVVAVGFWVRRSLP
FT                   ETPVFEEEKAQHKEAALPVVTLFRTQSADLLRVIFAALVSVVSTIGANYVLAYAVREVK
FT                   ISQPTTLLVLILANVVALAAIPLWAKLADRIGRRPVFIAGSLGSAVTVWPLFWAVSTGN
FT                   VPLMFVFGVLLSGVVYSAANGVWPSLYGEMFDTRVRLSGMAIGTQIGFALGGFAPTIAA
FT                   AIQGSGPTGWYPVAAFVTVTCLISAFSVYTARETYRTPLHALGRR"
     MSVHAVEAGA IAPAIPPAAT AAPRKAALAS WIGSAVEYYD FFIYGAAASL IFPKLFFSPD        60
     NPQAALMLSF ATFGVAYIAR PFGAIGLGHI GDRFGRKRVL TFTLLLMGFS TFIIGCLPTY       120
     AQAGLLAPTL LVLARFMQGI SAAGEQAGAN SMTLEHAPAD QRAFFTSFTL SGTQAGLILA       180
     NLVFLPITAL PEEQLLSWGW RIPFFLSALV VAVGFWVRRS LPETPVFEEE KAQHKEAALP       240
     VVTLFRTQSA DLLRVIFAAL VSVVSTIGAN YVLAYAVREV KISQPTTLLV LILANVVALA       300
     AIPLWAKLAD RIGRRPVFIA GSLGSAVTVW PLFWAVSTGN VPLMFVFGVL LSGVVYSAAN       360
     GVWPSLYGEM FDTRVRLSGM AIGTQIGFAL GGFAPTIAAA IQGSGPTGWY PVAAFVTVTC       420
     LISAFSVYTA RETYRTPLHA LGRR                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page