(data stored in ACNUC7421 zone)

EMBL: CP001349.PE113

CP001349.PE113       Location/Qualifiers
FT   CDS             complement(124972..125847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0118"
FT                   /product="Shikimate dehydrogenase substrate binding domain
FT                   protein"
FT                   /note="PFAM: Shikimate/quinate 5-dehydrogenase; Shikimate
FT                   dehydrogenase substrate binding domain protein; KEGG:
FT                   rso:RSp1398 shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55165"
FT                   /db_xref="GOA:B8IUC0"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC0"
FT                   /inference="protein motif:PFAM:PF08501"
FT                   /protein_id="ACL55165.1"
FT                   /translation="MSAPSRILLGLIGTGIQASRTPPMHEHEGDAQGLRVLYQTIDLER
FT                   LGLGPEALPELLTAAERMGFAGLNITHPCKQAVIPHLDALSPDAAALGAVNTVVLREGR
FT                   RVGHNTDWWGFAESFRRNLPGAALGRVVQLGAGGAGAAVAHALLTLGVQDLAIADVDPT
FT                   RAEQVAEGLCGRFGAGRARASTDLAADMAQADGLAHCTPTGMAAHPGLPLPAELLRPAL
FT                   WVAEIVYFPIETELLRVARGLGCRTLDGGGMAVFQAVEAFRLFTGREPDPARMLRHFAE
FT                   LGDKAAKTAA"
     MSAPSRILLG LIGTGIQASR TPPMHEHEGD AQGLRVLYQT IDLERLGLGP EALPELLTAA        60
     ERMGFAGLNI THPCKQAVIP HLDALSPDAA ALGAVNTVVL REGRRVGHNT DWWGFAESFR       120
     RNLPGAALGR VVQLGAGGAG AAVAHALLTL GVQDLAIADV DPTRAEQVAE GLCGRFGAGR       180
     ARASTDLAAD MAQADGLAHC TPTGMAAHPG LPLPAELLRP ALWVAEIVYF PIETELLRVA       240
     RGLGCRTLDG GGMAVFQAVE AFRLFTGREP DPARMLRHFA ELGDKAAKTA A                291
//

If you have problems or comments...

PBIL Back to PBIL home page