(data stored in ACNUC7421 zone)

EMBL: CP001349.PE114

CP001349.PE114       Location/Qualifiers
FT   CDS             126251..127201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0119"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: met:M446_4752 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55166"
FT                   /db_xref="GOA:B8IUC1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037424"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC1"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL55166.1"
FT                   /translation="MLTLRQIEVARAVMVTGTLAGAARLLNVSAPGISRLMKYTETSLG
FT                   IRLFDRRGGRMVPSEQARAVFEQINAVFDKVEDLRYVVERTRSGAAQELLIGSVPSISH
FT                   VMVPRAIERVRAKYPQLLIDINILKIEEAIDYLLLGKGEVVAMSYRLEHPALIFEPLAS
FT                   GNLYCIVPEHHALAAHESISAREIVKHPLIGIDPNDPYGRIMSDIFRARDLAYEITIRA
FT                   RFGSTVCSLVKAGLGIAVIDQFTIADGAFPGIRVLRIEEPTRFQTWIARKAGSTLSLFA
FT                   ESFVKDLRQEMTRQADMSPRAVARRAERISGQIIT"
     MLTLRQIEVA RAVMVTGTLA GAARLLNVSA PGISRLMKYT ETSLGIRLFD RRGGRMVPSE        60
     QARAVFEQIN AVFDKVEDLR YVVERTRSGA AQELLIGSVP SISHVMVPRA IERVRAKYPQ       120
     LLIDINILKI EEAIDYLLLG KGEVVAMSYR LEHPALIFEP LASGNLYCIV PEHHALAAHE       180
     SISAREIVKH PLIGIDPNDP YGRIMSDIFR ARDLAYEITI RARFGSTVCS LVKAGLGIAV       240
     IDQFTIADGA FPGIRVLRIE EPTRFQTWIA RKAGSTLSLF AESFVKDLRQ EMTRQADMSP       300
     RAVARRAERI SGQIIT                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page