(data stored in ACNUC7421 zone)

EMBL: CP001349.PE115

CP001349.PE115       Location/Qualifiers
FT   CDS             127329..128219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0120"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: met:M446_4753
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55167"
FT                   /db_xref="GOA:B8IUC2"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC2"
FT                   /inference="protein motif:TFAM:TIGR00507"
FT                   /protein_id="ACL55167.1"
FT                   /translation="MAPVQQQRFLLGLIGSPIKHSASPAMHEAAARALGMRAHYQLIDV
FT                   AGAGPALLRTLLDGLRLIGFAGANVTFPYKEAVVPLLDDLSEGARAVGAVNTIVVEDGR
FT                   LVGHNTDASGFARALTQRFGPAPRGPVALIGAGGVGKAIAVALSGFPGLEIRLVDRDPA
FT                   KAASLAAALAPRAALRVCGTVEQALDGAGGLVNGTPVGMLPNRGSPVPPHLLRPEIWVA
FT                   DAVYSPLWTPLLREAARLGAPTMTGRDLAIHQAVDAFRLFTGVDAPETAMAQAFDAAIA
FT                   AHAEEGSPPPPRSDG"
     MAPVQQQRFL LGLIGSPIKH SASPAMHEAA ARALGMRAHY QLIDVAGAGP ALLRTLLDGL        60
     RLIGFAGANV TFPYKEAVVP LLDDLSEGAR AVGAVNTIVV EDGRLVGHNT DASGFARALT       120
     QRFGPAPRGP VALIGAGGVG KAIAVALSGF PGLEIRLVDR DPAKAASLAA ALAPRAALRV       180
     CGTVEQALDG AGGLVNGTPV GMLPNRGSPV PPHLLRPEIW VADAVYSPLW TPLLREAARL       240
     GAPTMTGRDL AIHQAVDAFR LFTGVDAPET AMAQAFDAAI AAHAEEGSPP PPRSDG           296
//

If you have problems or comments...

PBIL Back to PBIL home page