(data stored in ACNUC7421 zone)

EMBL: CP001349.PE116

CP001349.PE116       Location/Qualifiers
FT   CDS             128363..129769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0121"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: met:M446_4754 major
FT                   facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55168"
FT                   /db_xref="GOA:B8IUC3"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL55168.1"
FT                   /translation="MSNAETHPDSHRRQQSKKAAASGWIGSALEYYDFFIYATAASLIF
FT                   PQIFFPAANPMVAIVASLATYGVGYVSRPIGAFVLGHWGDTHGRKYVLILCMFLMGFST
FT                   IAVGLLPTYEQVGILAPILLVVLRLIQGFAVAGEISGASSMILEHAPFGRRGFYASFTL
FT                   QGVQAGQILAAAVFLPLAHYMPAEAFNTWGWRIPFLLSVVVIIAGFIIRREVEETPAFA
FT                   EEGAHGEIPRSPVVEAFRTSWADMLRVVCMALMNVIPVVATIFGAAYAVQAAYGIGFEK
FT                   DVYLWIPVLGNIVAVLVIPYVGNLSDRIGRRPPIIIGAIGSGLLSFGYLYAISIHNVPL
FT                   AIAMSLLMWGVVYQGYNAVYPSFYPELFPTRTRVSAMAISQNLGTAITAMLPALFAAVA
FT                   PPGSANIPLTVGAITLAITVLAALAALSARETYRIRMSDLGQPGAVPVGKTEYDRLREE
FT                   LASGGRLAGA"
     MSNAETHPDS HRRQQSKKAA ASGWIGSALE YYDFFIYATA ASLIFPQIFF PAANPMVAIV        60
     ASLATYGVGY VSRPIGAFVL GHWGDTHGRK YVLILCMFLM GFSTIAVGLL PTYEQVGILA       120
     PILLVVLRLI QGFAVAGEIS GASSMILEHA PFGRRGFYAS FTLQGVQAGQ ILAAAVFLPL       180
     AHYMPAEAFN TWGWRIPFLL SVVVIIAGFI IRREVEETPA FAEEGAHGEI PRSPVVEAFR       240
     TSWADMLRVV CMALMNVIPV VATIFGAAYA VQAAYGIGFE KDVYLWIPVL GNIVAVLVIP       300
     YVGNLSDRIG RRPPIIIGAI GSGLLSFGYL YAISIHNVPL AIAMSLLMWG VVYQGYNAVY       360
     PSFYPELFPT RTRVSAMAIS QNLGTAITAM LPALFAAVAP PGSANIPLTV GAITLAITVL       420
     AALAALSARE TYRIRMSDLG QPGAVPVGKT EYDRLREELA SGGRLAGA                    468
//

If you have problems or comments...

PBIL Back to PBIL home page