(data stored in ACNUC7421 zone)

EMBL: CP001349.PE117

CP001349.PE117       Location/Qualifiers
FT   CDS             129870..131753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0122"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /EC_number="1.13.11.27"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: met:M446_4755 4-hydroxyphenylpyruvate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55169"
FT                   /db_xref="GOA:B8IUC4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC4"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACL55169.1"
FT                   /translation="MRLAIATVCLSGTLGEKLEAIAAAGFTQVEIFENDLLSFSGTPRD
FT                   VRRMAEDLGLSVAVYQPFRDFEGMPEPQRAKVFARAERKFDTMQELGCDLLMVCSNVSP
FT                   DSLGGIDRAAADFRELGERAQARGFRVGYEALAWGRHVNDYRDAWEIVRRADHPAVGFV
FT                   LDSFHVLARGTDLSAIRSIPKEKIVLVQMADAPKLAMDYLSWSRHYRCFPGQGELPITA
FT                   FADALGATGFDGLMSLEIFSDRFRAGSARSVAVDGRRSLLVMLDDLRRRSSVPNLPVLP
FT                   PRAACEGVEFIEFAMDDEAAASFERMLGGLGFARTARHRSKSVTRWSQGGINLVVNTEK
FT                   EGFAHSFQVTHGASVCAVALKVDDAQAAVERAVALLDEPFRQAVAPGELDIPAVRGVGG
FT                   SLLYFVDRRSGLDRLWNVDFEPVATEPTGDAGLIAVDHLSQSMRHEEMLTWLLFYTGLF
FT                   DLAQQPVQDVVDPGGVVQSQAVEAPGGALRLVLNASQSRQTLSSRFLSEAFGGGVQHVA
FT                   LATDDIFATVEALRANGVDLLPIPENYYDDLEVRTDLSAETIARLRAGNILYDRDGQAE
FT                   FFQVYTRSVLEGGFFFEIVERRDYRGYGAINAPIRLAAQTHLAPHPALPTR"
     MRLAIATVCL SGTLGEKLEA IAAAGFTQVE IFENDLLSFS GTPRDVRRMA EDLGLSVAVY        60
     QPFRDFEGMP EPQRAKVFAR AERKFDTMQE LGCDLLMVCS NVSPDSLGGI DRAAADFREL       120
     GERAQARGFR VGYEALAWGR HVNDYRDAWE IVRRADHPAV GFVLDSFHVL ARGTDLSAIR       180
     SIPKEKIVLV QMADAPKLAM DYLSWSRHYR CFPGQGELPI TAFADALGAT GFDGLMSLEI       240
     FSDRFRAGSA RSVAVDGRRS LLVMLDDLRR RSSVPNLPVL PPRAACEGVE FIEFAMDDEA       300
     AASFERMLGG LGFARTARHR SKSVTRWSQG GINLVVNTEK EGFAHSFQVT HGASVCAVAL       360
     KVDDAQAAVE RAVALLDEPF RQAVAPGELD IPAVRGVGGS LLYFVDRRSG LDRLWNVDFE       420
     PVATEPTGDA GLIAVDHLSQ SMRHEEMLTW LLFYTGLFDL AQQPVQDVVD PGGVVQSQAV       480
     EAPGGALRLV LNASQSRQTL SSRFLSEAFG GGVQHVALAT DDIFATVEAL RANGVDLLPI       540
     PENYYDDLEV RTDLSAETIA RLRAGNILYD RDGQAEFFQV YTRSVLEGGF FFEIVERRDY       600
     RGYGAINAPI RLAAQTHLAP HPALPTR                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page