(data stored in ACNUC7421 zone)

EMBL: CP001349.PE118

CP001349.PE118       Location/Qualifiers
FT   CDS             131777..132202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0123"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="TIGRFAM: 3-dehydroquinate dehydratase, type II;
FT                   PFAM: dehydroquinase class II; KEGG: met:M446_4756
FT                   3-dehydroquinate dehydratase, type II"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55170"
FT                   /db_xref="GOA:B8IUC5"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC5"
FT                   /inference="protein motif:TFAM:TIGR01088"
FT                   /protein_id="ACL55170.1"
FT                   /translation="MRDIHVLNGPNLNLLGIREPGIYGALTLADIERRLRDRAGARAAL
FT                   TFRQSNHEGDLVTWVHEAGAAGAGVILNAGAYTHTSVALRDAISGAKAEVIEVHLSNVH
FT                   ARESFRHHSYIAPVARGVIAGFGPLSYDLALEALLAA"
     MRDIHVLNGP NLNLLGIREP GIYGALTLAD IERRLRDRAG ARAALTFRQS NHEGDLVTWV        60
     HEAGAAGAGV ILNAGAYTHT SVALRDAISG AKAEVIEVHL SNVHARESFR HHSYIAPVAR       120
     GVIAGFGPLS YDLALEALLA A                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page