(data stored in ACNUC7421 zone)

EMBL: CP001349.PE119

CP001349.PE119       Location/Qualifiers
FT   CDS             complement(132491..132904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0124"
FT                   /product="transcriptional regulator, MucR family"
FT                   /note="PFAM: ROSMUCR transcriptional regulator; KEGG:
FT                   met:M446_6298 MucR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55171"
FT                   /db_xref="GOA:B8IUC6"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC6"
FT                   /inference="protein motif:PFAM:PF05443"
FT                   /protein_id="ACL55171.1"
FT                   /translation="MASDLTLITADIVSLYIMNNSIGADDLPNLIRSVHSALEDIDRVE
FT                   KPQPATLEPPVPIEQTVTPDYIVSLEDGKPYKTLGRHLHTKGLTPDQYRRKWGLPPDYP
FT                   MIAPSYAAHRAELAKRGSLGRKLGSRAEGDDAE"
     MASDLTLITA DIVSLYIMNN SIGADDLPNL IRSVHSALED IDRVEKPQPA TLEPPVPIEQ        60
     TVTPDYIVSL EDGKPYKTLG RHLHTKGLTP DQYRRKWGLP PDYPMIAPSY AAHRAELAKR       120
     GSLGRKLGSR AEGDDAE                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page