(data stored in ACNUC7421 zone)

EMBL: CP001349.PE12

CP001349.PE12        Location/Qualifiers
FT   CDS             14708..14893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55064"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT02"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55064.1"
FT                   /translation="MRALARAWRSRAFQDPQDASRNEAARPVSVTARPIEREQEHRGLT
FT                   ARELIRMAQSARIHRN"
     MRALARAWRS RAFQDPQDAS RNEAARPVSV TARPIEREQE HRGLTARELI RMAQSARIHR        60
     N                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page