(data stored in ACNUC7421 zone)

EMBL: CP001349.PE120

CP001349.PE120       Location/Qualifiers
FT   CDS             complement(133456..134328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0125"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /note="TIGRFAM: 2-dehydro-3-deoxyphosphooctonate aldolase;
FT                   PFAM: DAHP synthetase I/KDSA; KEGG: met:M446_4766
FT                   2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55172"
FT                   /db_xref="GOA:B8IUC7"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC7"
FT                   /inference="protein motif:TFAM:TIGR01362"
FT                   /protein_id="ACL55172.1"
FT                   /translation="MPFESPMMSTDSPSPGTVVAVGDVRFGNHLPLSLIAGPCALESRA
FT                   HALEVAAALKEMTAPLGLGLVFKSSFDKANRTSAGSARGLGLAEALPIFAEIRERLRLP
FT                   VLTDVHEAGQCAVAAEAVDILQIPAFLCRQTDLLLAAAATGRAVNVKKGQFLAPWDMAH
FT                   VAAKVTAAGNPNVIVTERGASFGYNTLVSDMRALPIMARVTNGAPVVFDATHSVQQPGG
FT                   QGATSGGQREFVPVLARAAVAVGVAGVFIETHPDPDRAPSDGPNMVPLRAMPALLGDLV
FT                   AFDRLAKAL"
     MPFESPMMST DSPSPGTVVA VGDVRFGNHL PLSLIAGPCA LESRAHALEV AAALKEMTAP        60
     LGLGLVFKSS FDKANRTSAG SARGLGLAEA LPIFAEIRER LRLPVLTDVH EAGQCAVAAE       120
     AVDILQIPAF LCRQTDLLLA AAATGRAVNV KKGQFLAPWD MAHVAAKVTA AGNPNVIVTE       180
     RGASFGYNTL VSDMRALPIM ARVTNGAPVV FDATHSVQQP GGQGATSGGQ REFVPVLARA       240
     AVAVGVAGVF IETHPDPDRA PSDGPNMVPL RAMPALLGDL VAFDRLAKAL                  290
//

If you have problems or comments...

PBIL Back to PBIL home page