(data stored in ACNUC7421 zone)

EMBL: CP001349.PE121

CP001349.PE121       Location/Qualifiers
FT   CDS             complement(134383..134919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0126"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   met:M446_4767 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55173"
FT                   /db_xref="GOA:B8IUC8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC8"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACL55173.1"
FT                   /translation="MRGPVTDPMIRALSGEEALARSEALAAILVDCVAGGASVSFMAPL
FT                   PQARAVAYWRDVAESVGRGERSLIVAEESDGTPVGTVQIVLAQPENQPHRADLSKVLVL
FT                   RRARRRGIGAGLMRAAEDAARRAGKTLLVLDTASPEAERLYERAGWSRVGVIPGYALLP
FT                   DGRPCDTVYFFKALA"
     MRGPVTDPMI RALSGEEALA RSEALAAILV DCVAGGASVS FMAPLPQARA VAYWRDVAES        60
     VGRGERSLIV AEESDGTPVG TVQIVLAQPE NQPHRADLSK VLVLRRARRR GIGAGLMRAA       120
     EDAARRAGKT LLVLDTASPE AERLYERAGW SRVGVIPGYA LLPDGRPCDT VYFFKALA         178
//

If you have problems or comments...

PBIL Back to PBIL home page