(data stored in ACNUC7421 zone)

EMBL: CP001349.PE122

CP001349.PE122       Location/Qualifiers
FT   CDS             complement(134923..135504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0127"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2
FT                   conserved barrel domain protein; KEGG: met:M446_4768 XRE
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55174"
FT                   /db_xref="GOA:B8IUC9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC9"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACL55174.1"
FT                   /translation="MDEPRSDLDARLAARLRGLRTAQGLTLEALAQRCGVSRSMISLVE
FT                   RAESSPTATVLERLSAGLGVSLAALFSPEHREDASPLSRRADQRCWRDPGTGYRRRNLS
FT                   PPGFSSPLELVEVELPPGSTVAYDSIRVPPLEQQVWVLDGTVVVTLGEAVHRLAAGDCL
FT                   AMRVDRPVAFHNPADHPARTLVAVSTGARA"
     MDEPRSDLDA RLAARLRGLR TAQGLTLEAL AQRCGVSRSM ISLVERAESS PTATVLERLS        60
     AGLGVSLAAL FSPEHREDAS PLSRRADQRC WRDPGTGYRR RNLSPPGFSS PLELVEVELP       120
     PGSTVAYDSI RVPPLEQQVW VLDGTVVVTL GEAVHRLAAG DCLAMRVDRP VAFHNPADHP       180
     ARTLVAVSTG ARA                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page