(data stored in ACNUC7421 zone)

EMBL: CP001349.PE123

CP001349.PE123       Location/Qualifiers
FT   CDS             135625..136527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55175"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD0"
FT                   /inference="similar to AA sequence:KEGG:M446_4769"
FT                   /protein_id="ACL55175.1"
FT                   /translation="MIPSGYSRTRAVAGGFLMSCLLAGPVAAIAHEAGQAEAEIDSEHL
FT                   FGFTEGSDIGVPGERELEQETTARIGRLRAGVVRAIDPTLALKLPLSSDFRIAPGLSFS
FT                   HFDLAATPGLPVRGESGFNGGFVETRLRLLDRRTAPIGLTLSVVPSIGTIDGGSGLAAR
FT                   AYGVEAALLADREIIPGLLVGALNLNLGLARAEFGGGETVRSSGLEVSGALAYRVRPWL
FT                   FLGGELRYARAYEGLGLDRFAGAALYLGPTLYAALSEGAWMSFTWGVQVAGGAAADPRP
FT                   LDLTNFDRHQLRLRVGLTF"
     MIPSGYSRTR AVAGGFLMSC LLAGPVAAIA HEAGQAEAEI DSEHLFGFTE GSDIGVPGER        60
     ELEQETTARI GRLRAGVVRA IDPTLALKLP LSSDFRIAPG LSFSHFDLAA TPGLPVRGES       120
     GFNGGFVETR LRLLDRRTAP IGLTLSVVPS IGTIDGGSGL AARAYGVEAA LLADREIIPG       180
     LLVGALNLNL GLARAEFGGG ETVRSSGLEV SGALAYRVRP WLFLGGELRY ARAYEGLGLD       240
     RFAGAALYLG PTLYAALSEG AWMSFTWGVQ VAGGAAADPR PLDLTNFDRH QLRLRVGLTF       300
//

If you have problems or comments...

PBIL Back to PBIL home page