(data stored in ACNUC7421 zone)

EMBL: CP001349.PE124

CP001349.PE124       Location/Qualifiers
FT   CDS             136917..138092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0129"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bra:BRADO5530 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55176"
FT                   /db_xref="GOA:B8ILL4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B8ILL4"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACL55176.1"
FT                   /translation="MRERVVPWQEVSVIDNRAEFVGLAQQEAANVAALCRRFGISRKTG
FT                   YKWLGRARSGAGLDDRSRRPHASPARTSPEMEEAVLELRTAHPSWGGRKLRRRLQDQGQ
FT                   EVVPAASTITAVLARHARLGQPDAPSIPFTRFEHPRPNALWQMDFKGHFAHAGGRCHPL
FT                   TVLDDHSRYALCLAACADEVTATVQGQLSATFRRYGLPERINLDNGSPWGNGPGQRYTP
FT                   LTVWLLRLGIHISHSRPYHPQTNGKDERFHRTLKRDVLHGAFYASLAACQRAFDRFRLI
FT                   YNSERPHEALGLAVPASRYQISRRAYPAELPAIEYDPTDQVRRVQRDGWISVRGQLVRV
FT                   PKAFVGQPLALRPTQTDGRVDLVFITHRVGQIDLTQPTLRVQPVTHVSEHL"
     MRERVVPWQE VSVIDNRAEF VGLAQQEAAN VAALCRRFGI SRKTGYKWLG RARSGAGLDD        60
     RSRRPHASPA RTSPEMEEAV LELRTAHPSW GGRKLRRRLQ DQGQEVVPAA STITAVLARH       120
     ARLGQPDAPS IPFTRFEHPR PNALWQMDFK GHFAHAGGRC HPLTVLDDHS RYALCLAACA       180
     DEVTATVQGQ LSATFRRYGL PERINLDNGS PWGNGPGQRY TPLTVWLLRL GIHISHSRPY       240
     HPQTNGKDER FHRTLKRDVL HGAFYASLAA CQRAFDRFRL IYNSERPHEA LGLAVPASRY       300
     QISRRAYPAE LPAIEYDPTD QVRRVQRDGW ISVRGQLVRV PKAFVGQPLA LRPTQTDGRV       360
     DLVFITHRVG QIDLTQPTLR VQPVTHVSEH L                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page