(data stored in ACNUC7421 zone)

EMBL: CP001349.PE125

CP001349.PE125       Location/Qualifiers
FT   CDS             complement(139557..141449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0131"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: met:M446_4771
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55177"
FT                   /db_xref="GOA:B8IUD2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACL55177.1"
FT                   /translation="MPEETRPGPVPASRTTLRGRVRKSATPTEPRRRQALAWAAALAIV
FT                   VLAAWSGGRIAERAALADLRRSALSGLTLQVAALRAEMQKQASLPLALAADPEIARVVA
FT                   AQAEPGLADRVSFRLSEIAGATGAAVIYVIRADGLTAAASNAGTATSFVGNDYTFRPYF
FT                   REALAEGAGSQFALGTVSGRPGLYLSRRIAGGSGVVVVKVEFDGVEAAWRGSGAQVFAT
FT                   DPRGIVLVSSEPAWRFRALGPVEAAERQRIRERLDFGNADLSPLPLHPVGESGLMRLGG
FT                   AATPARLVLPLDAAVPDTTWRLHTLTPVGAAVRRERLQTQVLAGVVAGAACAGIAVHLG
FT                   RRRRIRSRLAEEASRREELERRVQERTRALTDANAQLRAEMAERQRAEAERERLGRELA
FT                   QAGRLAALGQFAASMAHEINQPLAAIRSYADNAAILIRRGRIEDASENFSAIGRLTERI
FT                   AGLTRQLKGFARRASGRREPVSLAGVLRNALEVVEARAATGGVTLAVDRPEPDLIVLGD
FT                   GARLEQVVVNLLQNALDAVAGRPDPRVTVRAAALGDRALLEVGDNGPGIPDSVRAQVFD
FT                   PFFTTKAEGLGLGLAISRGIVEECGGTLAVATGEAGGAVFRVDLARTQAAEEAA"
     MPEETRPGPV PASRTTLRGR VRKSATPTEP RRRQALAWAA ALAIVVLAAW SGGRIAERAA        60
     LADLRRSALS GLTLQVAALR AEMQKQASLP LALAADPEIA RVVAAQAEPG LADRVSFRLS       120
     EIAGATGAAV IYVIRADGLT AAASNAGTAT SFVGNDYTFR PYFREALAEG AGSQFALGTV       180
     SGRPGLYLSR RIAGGSGVVV VKVEFDGVEA AWRGSGAQVF ATDPRGIVLV SSEPAWRFRA       240
     LGPVEAAERQ RIRERLDFGN ADLSPLPLHP VGESGLMRLG GAATPARLVL PLDAAVPDTT       300
     WRLHTLTPVG AAVRRERLQT QVLAGVVAGA ACAGIAVHLG RRRRIRSRLA EEASRREELE       360
     RRVQERTRAL TDANAQLRAE MAERQRAEAE RERLGRELAQ AGRLAALGQF AASMAHEINQ       420
     PLAAIRSYAD NAAILIRRGR IEDASENFSA IGRLTERIAG LTRQLKGFAR RASGRREPVS       480
     LAGVLRNALE VVEARAATGG VTLAVDRPEP DLIVLGDGAR LEQVVVNLLQ NALDAVAGRP       540
     DPRVTVRAAA LGDRALLEVG DNGPGIPDSV RAQVFDPFFT TKAEGLGLGL AISRGIVEEC       600
     GGTLAVATGE AGGAVFRVDL ARTQAAEEAA                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page