(data stored in ACNUC7421 zone)

EMBL: CP001349.PE126

CP001349.PE126       Location/Qualifiers
FT   CDS             141666..143015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0132"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   met:M446_4772 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55178"
FT                   /db_xref="GOA:B8IUD3"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD3"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ACL55178.1"
FT                   /translation="MAVTVPSPLTAPQAPPAPKPLYKTLYFQVLVAVAIGILLGHFYPQ
FT                   LGAEMKPLGDAFIKLVKMIIAPVIFLTVVSGIAGMTNLEKVGRVGAKALIYFITFSTLA
FT                   LIVGLVVANVLQPGHGLHIDPKSLDPKAVATYAGKAKEQSIVEFLMHIIPSTAVGAFAG
FT                   GEILQVLFFSVLFGFGLAFMGDRGKPVLDLIKVTAEAIFGVVHIIMKVAPIGAFGAMAF
FT                   TIGKYGVSSLANLAYLVFAFYLTSAIFVLVVLGPVARYNGFSVIKLVRYIKEELLLVLG
FT                   TSSSESALPTLIDKMERAGCSRPVVGLVVPTGYSFNLDGTNIYMTMAALFIAQATDTPL
FT                   SLGEQALLLLVAMLSSKGAAGVTGSGFITLAATLAVVPSVPVVGMALILGIDRFMSECR
FT                   ALTNFIGNAVACIVVARWEGEVDEARLAAALNGNPLPLAEDVPAILQPAE"
     MAVTVPSPLT APQAPPAPKP LYKTLYFQVL VAVAIGILLG HFYPQLGAEM KPLGDAFIKL        60
     VKMIIAPVIF LTVVSGIAGM TNLEKVGRVG AKALIYFITF STLALIVGLV VANVLQPGHG       120
     LHIDPKSLDP KAVATYAGKA KEQSIVEFLM HIIPSTAVGA FAGGEILQVL FFSVLFGFGL       180
     AFMGDRGKPV LDLIKVTAEA IFGVVHIIMK VAPIGAFGAM AFTIGKYGVS SLANLAYLVF       240
     AFYLTSAIFV LVVLGPVARY NGFSVIKLVR YIKEELLLVL GTSSSESALP TLIDKMERAG       300
     CSRPVVGLVV PTGYSFNLDG TNIYMTMAAL FIAQATDTPL SLGEQALLLL VAMLSSKGAA       360
     GVTGSGFITL AATLAVVPSV PVVGMALILG IDRFMSECRA LTNFIGNAVA CIVVARWEGE       420
     VDEARLAAAL NGNPLPLAED VPAILQPAE                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page