(data stored in ACNUC7421 zone)

EMBL: CP001349.PE127

CP001349.PE127       Location/Qualifiers
FT   CDS             complement(143121..143663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0133"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: met:M446_2672
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55179"
FT                   /db_xref="GOA:B8IUD4"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD4"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACL55179.1"
FT                   /translation="MILLRHGQSVFNLHYGATGEDPDIPDAPLTPLGHRQAEAAAEALA
FT                   GEGIRRILCSPYTRALQTAAPVAARLGLPVLVTCAVRERFAASCDIGTGRTALASAWPQ
FT                   LDFGAVAEVWWPDAEEPHDLFHARTTAFRSEMAADPDWAHTLVVCHWGVIMALTGRSLD
FT                   NGAWIRLERDERITLGE"
     MILLRHGQSV FNLHYGATGE DPDIPDAPLT PLGHRQAEAA AEALAGEGIR RILCSPYTRA        60
     LQTAAPVAAR LGLPVLVTCA VRERFAASCD IGTGRTALAS AWPQLDFGAV AEVWWPDAEE       120
     PHDLFHARTT AFRSEMAADP DWAHTLVVCH WGVIMALTGR SLDNGAWIRL ERDERITLGE       180
//

If you have problems or comments...

PBIL Back to PBIL home page