(data stored in ACNUC7421 zone)

EMBL: CP001349.PE128

CP001349.PE128       Location/Qualifiers
FT   CDS             complement(143660..145426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2673 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55180"
FT                   /db_xref="GOA:B8IUD5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD5"
FT                   /inference="similar to AA sequence:KEGG:M446_2673"
FT                   /protein_id="ACL55180.1"
FT                   /translation="MLVYGDTARTGDPPQWLARVAALCRQAAALPPGIERHGRLVAALI
FT                   EVGELGQGIADAIFVQHGADTPSAGSEAVTALLMALARAVRRSWSSGFTSCEAIPPGLL
FT                   EAVERTLLPTSITGKRAEGFAFYALYPEAYAAAAETSGLGGDTRVVGIRSIGLPLAAMT
FT                   ASALGASPPLTIRPVGHPFERRLSLSRAMDDALCGDLRGDIAIVDEGPGLSGSSFGAVA
FT                   DHLEARGVAPARLVFFPGHTGEPGPMARARHRARWATTRRIAIGFDELVLDAREPVHRL
FT                   DSWVASLIGPLDGPLDDISGGAWRSLQAAPFDAWPPVHAQQERRKFLARADGATWLVKF
FT                   AGLGAAGDEALALARQLQAAGFTPPVAGLVHGFLVERWLAEARPLTSGAIDPLRLAEAV
FT                   GHYLAFRARTLPAEPGRGAALSDLVAMARHNTAEALGHDTARLFDPWDERRVAGLAERV
FT                   RPVLIDGRLQPWEWLLLPDGSLRKADALEHHAGHDLVGCQDIAWDVAGAAIELDLPPDA
FT                   QECLASTMVREGARWPDPDLLALLALCYLAFRLGASSLAAESGAAPDEAQRLRRAASAY
FT                   GARLGRLLRDGG"
     MLVYGDTART GDPPQWLARV AALCRQAAAL PPGIERHGRL VAALIEVGEL GQGIADAIFV        60
     QHGADTPSAG SEAVTALLMA LARAVRRSWS SGFTSCEAIP PGLLEAVERT LLPTSITGKR       120
     AEGFAFYALY PEAYAAAAET SGLGGDTRVV GIRSIGLPLA AMTASALGAS PPLTIRPVGH       180
     PFERRLSLSR AMDDALCGDL RGDIAIVDEG PGLSGSSFGA VADHLEARGV APARLVFFPG       240
     HTGEPGPMAR ARHRARWATT RRIAIGFDEL VLDAREPVHR LDSWVASLIG PLDGPLDDIS       300
     GGAWRSLQAA PFDAWPPVHA QQERRKFLAR ADGATWLVKF AGLGAAGDEA LALARQLQAA       360
     GFTPPVAGLV HGFLVERWLA EARPLTSGAI DPLRLAEAVG HYLAFRARTL PAEPGRGAAL       420
     SDLVAMARHN TAEALGHDTA RLFDPWDERR VAGLAERVRP VLIDGRLQPW EWLLLPDGSL       480
     RKADALEHHA GHDLVGCQDI AWDVAGAAIE LDLPPDAQEC LASTMVREGA RWPDPDLLAL       540
     LALCYLAFRL GASSLAAESG AAPDEAQRLR RAASAYGARL GRLLRDGG                    588
//

If you have problems or comments...

PBIL Back to PBIL home page