(data stored in ACNUC7421 zone)

EMBL: CP001349.PE129

CP001349.PE129       Location/Qualifiers
FT   CDS             145840..147588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0135"
FT                   /product="ankyrin"
FT                   /note="KEGG: met:M446_2674 ankyrin"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55181"
FT                   /db_xref="GOA:B8IUD6"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR019020"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD6"
FT                   /inference="similar to AA sequence:KEGG:M446_2674"
FT                   /protein_id="ACL55181.1"
FT                   /translation="MNEMVSKDRLAAVRPQAVGARPKGDRLPTSDVGTVILHWSSAVAM
FT                   VASLVTGLRISADALDAVVSRWISPVLPQGEVWTVHIFAGLLLFAVSVAYVVYMARSGL
FT                   ANRITLRKMRALQYAQTASLRWMGVNVLLHWLLFGLVTVLAATGILLYLGHGGWVVTVH
FT                   EAAAYGTLAYTLAHLVGHFGYGGWRQWLRIFRPAALVPSPAQRSRRPMLVAGLVTVPAV
FT                   AGAVALDLGSRGTLTVERVETPPVLDGVLDDAAWRAARPVRVRTQQGANLGGSGESTVE
FT                   IRAVQDGSRIHFAFRWQDPTRSLARLPMVKQADGWHVHGKGAGEADVVDFYEDKFAAIF
FT                   SHADGFGAAGVTHLGQKPLADKPSSLNRRGLHYTTDGSIVDMWQWKASRGGLLGHVDDQ
FT                   YMGPPREPTPDEAAQRARYQGGYWNDPGTTIYSYNFPFEGPGGYAGPVKPKRLPVDAAA
FT                   TMAALGRFDLANPDASYDEGSRWWLTEADSRPYSEEDDARIPVGTVIPGVLNIGRYEGD
FT                   RADLRGGARWKDGFWTLEVSRALRTGSRYDVDFVKGEPLYLWVAVFDHTQTRHTRHVRP
FT                   VRIDLR"
     MNEMVSKDRL AAVRPQAVGA RPKGDRLPTS DVGTVILHWS SAVAMVASLV TGLRISADAL        60
     DAVVSRWISP VLPQGEVWTV HIFAGLLLFA VSVAYVVYMA RSGLANRITL RKMRALQYAQ       120
     TASLRWMGVN VLLHWLLFGL VTVLAATGIL LYLGHGGWVV TVHEAAAYGT LAYTLAHLVG       180
     HFGYGGWRQW LRIFRPAALV PSPAQRSRRP MLVAGLVTVP AVAGAVALDL GSRGTLTVER       240
     VETPPVLDGV LDDAAWRAAR PVRVRTQQGA NLGGSGESTV EIRAVQDGSR IHFAFRWQDP       300
     TRSLARLPMV KQADGWHVHG KGAGEADVVD FYEDKFAAIF SHADGFGAAG VTHLGQKPLA       360
     DKPSSLNRRG LHYTTDGSIV DMWQWKASRG GLLGHVDDQY MGPPREPTPD EAAQRARYQG       420
     GYWNDPGTTI YSYNFPFEGP GGYAGPVKPK RLPVDAAATM AALGRFDLAN PDASYDEGSR       480
     WWLTEADSRP YSEEDDARIP VGTVIPGVLN IGRYEGDRAD LRGGARWKDG FWTLEVSRAL       540
     RTGSRYDVDF VKGEPLYLWV AVFDHTQTRH TRHVRPVRID LR                          582
//

If you have problems or comments...

PBIL Back to PBIL home page