(data stored in ACNUC7421 zone)

EMBL: CP001349.PE13

CP001349.PE13        Location/Qualifiers
FT   CDS             15480..15659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_0009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55065"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT03"
FT                   /inference="similar to AA sequence:KEGG:M446_0009"
FT                   /protein_id="ACL55065.1"
FT                   /translation="MPDFDARHLDDAEALARLAEILHPTKALRAQAKARGRRREREGLV
FT                   AAAKPADAKSDEAA"
     MPDFDARHLD DAEALARLAE ILHPTKALRA QAKARGRRRE REGLVAAAKP ADAKSDEAA         59
//

If you have problems or comments...

PBIL Back to PBIL home page