(data stored in ACNUC7421 zone)

EMBL: CP001349.PE130

CP001349.PE130       Location/Qualifiers
FT   CDS             147609..148652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0136"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: met:M446_2675 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55182"
FT                   /db_xref="GOA:B8IUD7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD7"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ACL55182.1"
FT                   /translation="MSSTCSLVINGKAIRAARGDTLVEAALAGKIVIPHDCGTGQCDTC
FT                   RVRIYAGEVDACGTRQGSTVLACQARVSGDAVIEFDAVPAVVKRKGTVTGLVALSPEIV
FT                   EVTVALGKGLGHRPGQYVACSFAGFPARDYSPTLRSDGSGELNELIFHIRRIPDGIVSS
FT                   ELGRRIRVGHEVRVRGPFGSAFHRLGSGRLVLIGAGTGWAPIWSIARAARFREPDREMV
FT                   VIAGARDPHNLHMGEALDWLSRSGVGQVVATASGGEPKPGQLAGRPTAHLPHLRESDVV
FT                   HVAGSPALVAAIRLLAASVNATCYADPFVASARKRSLRHKLFDLLFARRPSADPEVPVP
FT                   AAPRSAA"
     MSSTCSLVIN GKAIRAARGD TLVEAALAGK IVIPHDCGTG QCDTCRVRIY AGEVDACGTR        60
     QGSTVLACQA RVSGDAVIEF DAVPAVVKRK GTVTGLVALS PEIVEVTVAL GKGLGHRPGQ       120
     YVACSFAGFP ARDYSPTLRS DGSGELNELI FHIRRIPDGI VSSELGRRIR VGHEVRVRGP       180
     FGSAFHRLGS GRLVLIGAGT GWAPIWSIAR AARFREPDRE MVVIAGARDP HNLHMGEALD       240
     WLSRSGVGQV VATASGGEPK PGQLAGRPTA HLPHLRESDV VHVAGSPALV AAIRLLAASV       300
     NATCYADPFV ASARKRSLRH KLFDLLFARR PSADPEVPVP AAPRSAA                     347
//

If you have problems or comments...

PBIL Back to PBIL home page