(data stored in ACNUC7421 zone)

EMBL: CP001349.PE131

CP001349.PE131       Location/Qualifiers
FT   CDS             148894..149103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0137"
FT                   /product="YcfA family protein"
FT                   /note="PFAM: YcfA family protein; KEGG: sme:SMc04441
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55183"
FT                   /db_xref="GOA:B8IUD8"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD8"
FT                   /inference="protein motif:PFAM:PF07927"
FT                   /protein_id="ACL55183.1"
FT                   /translation="MSGRKRSRKTRDVIAALFKDDWELYRKGPGDHIQFKHQNKLGKVT
FT                   VDNGEPEIPTGTLRNIYRQAGWEW"
     MSGRKRSRKT RDVIAALFKD DWELYRKGPG DHIQFKHQNK LGKVTVDNGE PEIPTGTLRN        60
     IYRQAGWEW                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page