(data stored in ACNUC7421 zone)

EMBL: CP001349.PE132

CP001349.PE132       Location/Qualifiers
FT   CDS             149158..149574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0138"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; protein of unknown function UPF0150; KEGG:
FT                   nha:Nham_0567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55184"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD9"
FT                   /inference="protein motif:PFAM:PF03681"
FT                   /protein_id="ACL55184.1"
FT                   /translation="MARIVMLIHEEGGVYGASFPDFPGATTVAGDLDTLYTKAAEMLAF
FT                   HVEGMVEDGDEIPVPRTLQELREDPVFREDAEGAIIGLVEVELPGKAVRVNISIEESIL
FT                   RRIDRAAETAGETRSGFLVAAAKARLAQTSGVSR"
     MARIVMLIHE EGGVYGASFP DFPGATTVAG DLDTLYTKAA EMLAFHVEGM VEDGDEIPVP        60
     RTLQELREDP VFREDAEGAI IGLVEVELPG KAVRVNISIE ESILRRIDRA AETAGETRSG       120
     FLVAAAKARL AQTSGVSR                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page