(data stored in ACNUC7421 zone)

EMBL: CP001349.PE133

CP001349.PE133       Location/Qualifiers
FT   CDS             complement(149680..150477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55185"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE0"
FT                   /inference="similar to AA sequence:KEGG:M446_2676"
FT                   /protein_id="ACL55185.1"
FT                   /translation="MPSAPRLALALAACLFARPSLAAELAVVGTGDGIDLLRALGTSAH
FT                   EADASLEIAVPPSIGSDGGIAAVGSGKSPLARVARRLTEAETARGLVYTPIARLPSAIF
FT                   VHPSARVAGLTADQLLAIYAGRVTNWKEVGGADLRIRVVRREEADSTLRILRASMPGWA
FT                   DLVITERSKTAVSTQEAIETVRLVEGAIGFGPYSRTLEVGTRVLAIDGRLPTDPGYPSA
FT                   GELAFVHMNGQLPPAASRFVSFAQQAATAHEVIRSFGAVPIER"
     MPSAPRLALA LAACLFARPS LAAELAVVGT GDGIDLLRAL GTSAHEADAS LEIAVPPSIG        60
     SDGGIAAVGS GKSPLARVAR RLTEAETARG LVYTPIARLP SAIFVHPSAR VAGLTADQLL       120
     AIYAGRVTNW KEVGGADLRI RVVRREEADS TLRILRASMP GWADLVITER SKTAVSTQEA       180
     IETVRLVEGA IGFGPYSRTL EVGTRVLAID GRLPTDPGYP SAGELAFVHM NGQLPPAASR       240
     FVSFAQQAAT AHEVIRSFGA VPIER                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page