(data stored in ACNUC7421 zone)

EMBL: CP001349.PE134

CP001349.PE134       Location/Qualifiers
FT   CDS             complement(150626..151825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0140"
FT                   /product="hydrolase, peptidase M42 family"
FT                   /note="TIGRFAM: hydrolase, peptidase M42 family; PFAM:
FT                   peptidase M20; peptidase M42 family protein; KEGG:
FT                   met:M446_2678 peptidase M42 family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55186"
FT                   /db_xref="GOA:B8IUE1"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR017537"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE1"
FT                   /inference="protein motif:TFAM:TIGR03106"
FT                   /protein_id="ACL55186.1"
FT                   /translation="MNKPFAAASAAIASAPMRIDVDYMLDFLKRLIEIPSPTGYTDQAV
FT                   HFCGRELERLGVPFELTRRGAIRATLKGAGPGPARAMVSHLDTLGAMVKQLKDNGRLAL
FT                   VPIGTWSARFAEGARCTIFTDQGSYRGTILPLKASGHTFNEEVDTQPVDWTNVEMRVDA
FT                   FSYRVEDLRRLGFNVGDFVAVDPNPEFSPRGYLNSRHLDDKAGVAVMIAAMKAMADAGR
FT                   KPTVDTFMLFTIAEEIGVGASSVLHGDIAEMVTIDNGTVAPGQASRESGVTICMADSAG
FT                   PFDYHLTRRLIELCEANDIRYERDAFRYYRSDSASALEAGNDLRTALICFGVDSSHGYE
FT                   RTHVNALRSLAELSCLYLQSDVLFGRDVKPLGPLAGFPRQESESADPASEMVEDTILPG
FT                   "
     MNKPFAAASA AIASAPMRID VDYMLDFLKR LIEIPSPTGY TDQAVHFCGR ELERLGVPFE        60
     LTRRGAIRAT LKGAGPGPAR AMVSHLDTLG AMVKQLKDNG RLALVPIGTW SARFAEGARC       120
     TIFTDQGSYR GTILPLKASG HTFNEEVDTQ PVDWTNVEMR VDAFSYRVED LRRLGFNVGD       180
     FVAVDPNPEF SPRGYLNSRH LDDKAGVAVM IAAMKAMADA GRKPTVDTFM LFTIAEEIGV       240
     GASSVLHGDI AEMVTIDNGT VAPGQASRES GVTICMADSA GPFDYHLTRR LIELCEANDI       300
     RYERDAFRYY RSDSASALEA GNDLRTALIC FGVDSSHGYE RTHVNALRSL AELSCLYLQS       360
     DVLFGRDVKP LGPLAGFPRQ ESESADPASE MVEDTILPG                              399
//

If you have problems or comments...

PBIL Back to PBIL home page