(data stored in ACNUC7421 zone)

EMBL: CP001349.PE135

CP001349.PE135       Location/Qualifiers
FT   CDS             complement(151828..153537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0141"
FT                   /product="GNAT-family acetyltransferase TIGR03103"
FT                   /EC_number="6.3.2.3"
FT                   /note="TIGRFAM: GNAT-family acetyltransferase TIGR03103;
FT                   PFAM: phosphoribosylglycinamide synthetase; GCN5-related
FT                   N-acetyltransferase; RimK domain protein ATP-grasp; KEGG:
FT                   met:M446_2679 GNAT family acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55187"
FT                   /db_xref="GOA:B8IUE2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017534"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE2"
FT                   /inference="protein motif:TFAM:TIGR03103"
FT                   /protein_id="ACL55187.1"
FT                   /translation="MANPIPMPSSAEQSAPAAANVAVECGWGRLIFGQTFRDPADLVDL
FT                   LLQEQPGRRDVAFYVAEPHVVLALAPTELFLDPSHAYRLDLRGFDAAAGAPQGFRVRPV
FT                   TGSADIAEINRICRARHMVQIDPAFAWPPREDGVLTYLVAEDSQTGAILGAATGIDHVA
FT                   AFGDSENASSLWSLAVDPQTPHPGVGEGLVRALAGHFRARGREVMDLSVMHDNAQAIAL
FT                   YEKLGFVRLPVFTIKTKNSFNEKLYIGPSPDGALNPYAQIITNEARRRGITVEVVDEPT
FT                   SLFRLSHGGRSFVCRESLSSATSAAAMTICDDKALTRRLLAGAGLRVPDQGVATDEAAA
FT                   RAFLKKHGAVVVKPARGEQGRGIAVNLTTPEEVSAAVAEAKRVCDTVLLEEFVEGEDLR
FT                   VIVIDFKVVAAAIRRPAQVVGTGRHSVRELIERQSRRRAAATGGESRIPLDDETRRCVE
FT                   RAGHSLDDVPAAGATLLVRRTANLHTGGTIHDVTDAIHPELVAASVKAARVIDIPVVGL
FT                   DLMVPDIRGPEHWFIEANERPGLANHEPQPTAERFVDMLFPQTIAAARVRRH"
     MANPIPMPSS AEQSAPAAAN VAVECGWGRL IFGQTFRDPA DLVDLLLQEQ PGRRDVAFYV        60
     AEPHVVLALA PTELFLDPSH AYRLDLRGFD AAAGAPQGFR VRPVTGSADI AEINRICRAR       120
     HMVQIDPAFA WPPREDGVLT YLVAEDSQTG AILGAATGID HVAAFGDSEN ASSLWSLAVD       180
     PQTPHPGVGE GLVRALAGHF RARGREVMDL SVMHDNAQAI ALYEKLGFVR LPVFTIKTKN       240
     SFNEKLYIGP SPDGALNPYA QIITNEARRR GITVEVVDEP TSLFRLSHGG RSFVCRESLS       300
     SATSAAAMTI CDDKALTRRL LAGAGLRVPD QGVATDEAAA RAFLKKHGAV VVKPARGEQG       360
     RGIAVNLTTP EEVSAAVAEA KRVCDTVLLE EFVEGEDLRV IVIDFKVVAA AIRRPAQVVG       420
     TGRHSVRELI ERQSRRRAAA TGGESRIPLD DETRRCVERA GHSLDDVPAA GATLLVRRTA       480
     NLHTGGTIHD VTDAIHPELV AASVKAARVI DIPVVGLDLM VPDIRGPEHW FIEANERPGL       540
     ANHEPQPTAE RFVDMLFPQT IAAARVRRH                                         569
//

If you have problems or comments...

PBIL Back to PBIL home page