(data stored in ACNUC7421 zone)

EMBL: CP001349.PE136

CP001349.PE136       Location/Qualifiers
FT   CDS             complement(153541..155313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0142"
FT                   /product="asparagine synthase family amidotransferase"
FT                   /EC_number="6.3.5.4"
FT                   /note="TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); asparagine synthase family
FT                   amidotransferase; PFAM: glutamine amidotransferase
FT                   class-II; asparagine synthase; KEGG: met:M446_2680
FT                   asparagine synthase amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55188"
FT                   /db_xref="GOA:B8IUE3"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017535"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE3"
FT                   /inference="protein motif:TFAM:TIGR03104"
FT                   /protein_id="ACL55188.1"
FT                   /translation="MCGICGEIRLDGAPPDAAAVAAMAVPLRARGPDAGGSFAQGGIAF
FT                   GHRRLSILDLSPASQQPMVDPGLGLAIVFNGCIYNFRSLREELRAKGYAFFSEGDTEVI
FT                   LKAYHAWGPRCVERFYGMFAFVLWERDSGRVVIARDRLGIKPLYYAESGSRLRFASSLP
FT                   ALLAAGDLDRSIDPAALHHYMSFHAVVPAPLTILKGVRKVPPATIITIEPDGRRRQETY
FT                   WEAVVTERPDDRHMTESDWCEAVLATLRKAVERRLVSDVPVGVLLSGGLDSSIVVALLA
FT                   EAGQRGLKTFSIGFESVGGEAGDEFTYSDIIAERFATDHHRIRIDSARALPALHGAVAA
FT                   MSEPMVSHDAVGFYLLSEEVSKHVKVVQSGQGADEIFGGYHWYPPMMQSTDAVADYARV
FT                   FFDRDHAEMREALSPSLVDGDVSRAFVEAHFARAGAPRPIDKALRIDTEIMLVDDPVKR
FT                   VDNMTMAWGLEARVPFLDHDLVELAGRVPADLKIRDGGKFILKQAGRRVVPSEVIDRPK
FT                   GYFPVPALKYLRGPFLDLVRDVLNEPVARERGLFNRAYVDRLLAEPEAHMTPLRGSKLW
FT                   QVALLEFWLQTHAI"
     MCGICGEIRL DGAPPDAAAV AAMAVPLRAR GPDAGGSFAQ GGIAFGHRRL SILDLSPASQ        60
     QPMVDPGLGL AIVFNGCIYN FRSLREELRA KGYAFFSEGD TEVILKAYHA WGPRCVERFY       120
     GMFAFVLWER DSGRVVIARD RLGIKPLYYA ESGSRLRFAS SLPALLAAGD LDRSIDPAAL       180
     HHYMSFHAVV PAPLTILKGV RKVPPATIIT IEPDGRRRQE TYWEAVVTER PDDRHMTESD       240
     WCEAVLATLR KAVERRLVSD VPVGVLLSGG LDSSIVVALL AEAGQRGLKT FSIGFESVGG       300
     EAGDEFTYSD IIAERFATDH HRIRIDSARA LPALHGAVAA MSEPMVSHDA VGFYLLSEEV       360
     SKHVKVVQSG QGADEIFGGY HWYPPMMQST DAVADYARVF FDRDHAEMRE ALSPSLVDGD       420
     VSRAFVEAHF ARAGAPRPID KALRIDTEIM LVDDPVKRVD NMTMAWGLEA RVPFLDHDLV       480
     ELAGRVPADL KIRDGGKFIL KQAGRRVVPS EVIDRPKGYF PVPALKYLRG PFLDLVRDVL       540
     NEPVARERGL FNRAYVDRLL AEPEAHMTPL RGSKLWQVAL LEFWLQTHAI                  590
//

If you have problems or comments...

PBIL Back to PBIL home page