(data stored in ACNUC7421 zone)

EMBL: CP001349.PE137

CP001349.PE137       Location/Qualifiers
FT   CDS             155543..155935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0143"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   met:M446_2682 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55189"
FT                   /db_xref="GOA:B8IUE4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL55189.1"
FT                   /translation="MGGGRVENVLVVEDEVLLLDLVTAELEDAGLTVLQADNANAALGM
FT                   LATDTPVDLLFTDIRLPGPMDGWTLAEAALKLRPGLKVIYATGFAGDAPRLAPGSLFFT
FT                   KPYRPSAVIAAIAAFGTAEPPSPAVP"
     MGGGRVENVL VVEDEVLLLD LVTAELEDAG LTVLQADNAN AALGMLATDT PVDLLFTDIR        60
     LPGPMDGWTL AEAALKLRPG LKVIYATGFA GDAPRLAPGS LFFTKPYRPS AVIAAIAAFG       120
     TAEPPSPAVP                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page