(data stored in ACNUC7421 zone)

EMBL: CP001349.PE138

CP001349.PE138       Location/Qualifiers
FT   CDS             156242..159271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0144"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: met:M446_2683 multi-sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; Hpt domain
FT                   protein; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55190"
FT                   /db_xref="GOA:B8IUE5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE5"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACL55190.1"
FT                   /translation="MARAGMKASTETPLDRIDRLRPSTRTPGTRRSACATLLIGVSGLT
FT                   GWAGAAVAGESSALPAGWFGPALGIGLAAAVAAAAAAGAAAAAAIVLWRGRAQRASGAG
FT                   ARVGTGPPAAAAAASGPESRVDAARTAALLGKTLDCMDQGVILVGPDRTVQVANRRARE
FT                   WLGLSEAFIASRPSYREVRALARRSPHWGSLVADTPLQLSEDDPAATHTVAERRNAEGT
FT                   VLEIRTVRTEDGGLIQTLTDITERRSAEDRYRLLAENATDLISLQSIRGGTKTYVSPSA
FT                   RAVVGWEPEEFAQLTLAQQLHPDDLARVKREAASLTPDAPRRTSEYRLRHKSGHYVWVE
FT                   STLLLTKPGTPDEALIIASRDVTARRAADDALRESEARHRLLAERTGDVIARADLDGTL
FT                   RYLSPSVEPVTGYAADALLGRSAMAHVHPQDRRTVLHRYAALVAAGPGARAKFEYRVRH
FT                   RHGHDVWLEVNPTVLYDEATGVPLGFVDVARDVTARKAVDAELAAAREQAEAARVHAEL
FT                   ASQAKTDFLASMSHEIRTPLSSVIGYTELLLDDPDLTEGQRLQASRIRSAGSALLTVVD
FT                   DILDFSKIEAGQVDLDLMPFALHGLIENAVAIVRQLAERKGLEIRVDIDPALPQTLVGD
FT                   QNRLRQILLNFLNNALKFTRRGRVVLAVATAGSTDRGWPIRVSVTDTGIGIAPEQQARL
FT                   FKRFTQVDGSIRREFGGTGLGLAISKKLIELMGGAIGVVSAPGEGSTFWFEVVLPEASA
FT                   APAPAEAPLARPVRPARILLVEDLIVNQDLARAVLERAGHMVDVANDGLEAIAAVQAKD
FT                   YDLVLMDVQMPGMDGVTATRHIRALPQRVSLIPIIAMTANVLPAQVSEFRAAGMNDHLG
FT                   KPFRRDELQAVIDRWIGEGTVAPHPGAGAAAAVDRRVYDDVVDLLGPDRLAHFLDELAR
FT                   EIRDRLSDARLAADDPQRLARDAHSLVASAGTLGFSELSGLCKQLEEACQSGASGDLLA
FT                   AVRASRDRALDEIERLHTVA"
     MARAGMKAST ETPLDRIDRL RPSTRTPGTR RSACATLLIG VSGLTGWAGA AVAGESSALP        60
     AGWFGPALGI GLAAAVAAAA AAGAAAAAAI VLWRGRAQRA SGAGARVGTG PPAAAAAASG       120
     PESRVDAART AALLGKTLDC MDQGVILVGP DRTVQVANRR AREWLGLSEA FIASRPSYRE       180
     VRALARRSPH WGSLVADTPL QLSEDDPAAT HTVAERRNAE GTVLEIRTVR TEDGGLIQTL       240
     TDITERRSAE DRYRLLAENA TDLISLQSIR GGTKTYVSPS ARAVVGWEPE EFAQLTLAQQ       300
     LHPDDLARVK REAASLTPDA PRRTSEYRLR HKSGHYVWVE STLLLTKPGT PDEALIIASR       360
     DVTARRAADD ALRESEARHR LLAERTGDVI ARADLDGTLR YLSPSVEPVT GYAADALLGR       420
     SAMAHVHPQD RRTVLHRYAA LVAAGPGARA KFEYRVRHRH GHDVWLEVNP TVLYDEATGV       480
     PLGFVDVARD VTARKAVDAE LAAAREQAEA ARVHAELASQ AKTDFLASMS HEIRTPLSSV       540
     IGYTELLLDD PDLTEGQRLQ ASRIRSAGSA LLTVVDDILD FSKIEAGQVD LDLMPFALHG       600
     LIENAVAIVR QLAERKGLEI RVDIDPALPQ TLVGDQNRLR QILLNFLNNA LKFTRRGRVV       660
     LAVATAGSTD RGWPIRVSVT DTGIGIAPEQ QARLFKRFTQ VDGSIRREFG GTGLGLAISK       720
     KLIELMGGAI GVVSAPGEGS TFWFEVVLPE ASAAPAPAEA PLARPVRPAR ILLVEDLIVN       780
     QDLARAVLER AGHMVDVAND GLEAIAAVQA KDYDLVLMDV QMPGMDGVTA TRHIRALPQR       840
     VSLIPIIAMT ANVLPAQVSE FRAAGMNDHL GKPFRRDELQ AVIDRWIGEG TVAPHPGAGA       900
     AAAVDRRVYD DVVDLLGPDR LAHFLDELAR EIRDRLSDAR LAADDPQRLA RDAHSLVASA       960
     GTLGFSELSG LCKQLEEACQ SGASGDLLAA VRASRDRALD EIERLHTVA                  1009
//

If you have problems or comments...

PBIL Back to PBIL home page