(data stored in ACNUC7421 zone)

EMBL: CP001349.PE139

CP001349.PE139       Location/Qualifiers
FT   CDS             complement(159593..160138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0145"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   met:M446_4615 CoA-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55191"
FT                   /db_xref="GOA:B8IUE6"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE6"
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /protein_id="ACL55191.1"
FT                   /translation="MPDVSNAARHDDYDTEHLRGLLRSVRSIALVGASANPARPSWIVT
FT                   KYLLERGYDVIPVNPGLAGQELLGRRVVGRLSELGRPVDMVEIFRNSEAAGPLVDEALA
FT                   LDPLPKVIWMQLGVRNDAAAAKAEARGITVVMNRCPKIEYGRLSGEIGWTGVNSRILSA
FT                   KRPKLAARGFQKLTIEKR"
     MPDVSNAARH DDYDTEHLRG LLRSVRSIAL VGASANPARP SWIVTKYLLE RGYDVIPVNP        60
     GLAGQELLGR RVVGRLSELG RPVDMVEIFR NSEAAGPLVD EALALDPLPK VIWMQLGVRN       120
     DAAAAKAEAR GITVVMNRCP KIEYGRLSGE IGWTGVNSRI LSAKRPKLAA RGFQKLTIEK       180
     R                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page