(data stored in ACNUC7421 zone)

EMBL: CP001349.PE14

CP001349.PE14        Location/Qualifiers
FT   CDS             complement(15663..16535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_0010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55066"
FT                   /db_xref="GOA:B8IT04"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT04"
FT                   /inference="similar to AA sequence:KEGG:M446_0010"
FT                   /protein_id="ACL55066.1"
FT                   /translation="MSDGKDQAGASAPGTSAASAEASLKDAVTSARAALPKAEAFRKVP
FT                   AFRLKLRPPIAAALLGGLCLGSFGGGAAVALLTKGARAERPAIGQAEWKKLATRLDAQA
FT                   AESARLATDIKLLKDRTAEAHDAAEKARAESGTRFGQLAERLDRLNKVGGETATKLAGL
FT                   SEKLDHFDREQSARVTALGEKVERQRSAAPAAPAPAAPAAKVAAAEPALTGSLPDKPAA
FT                   KPAPTLVDGWTLRDVYDGVAMIENRNRRLVEVGPGDTVPGIGRVEAIERRGKTWVVVTN
FT                   RGLITSQLW"
     MSDGKDQAGA SAPGTSAASA EASLKDAVTS ARAALPKAEA FRKVPAFRLK LRPPIAAALL        60
     GGLCLGSFGG GAAVALLTKG ARAERPAIGQ AEWKKLATRL DAQAAESARL ATDIKLLKDR       120
     TAEAHDAAEK ARAESGTRFG QLAERLDRLN KVGGETATKL AGLSEKLDHF DREQSARVTA       180
     LGEKVERQRS AAPAAPAPAA PAAKVAAAEP ALTGSLPDKP AAKPAPTLVD GWTLRDVYDG       240
     VAMIENRNRR LVEVGPGDTV PGIGRVEAIE RRGKTWVVVT NRGLITSQLW                  290
//

If you have problems or comments...

PBIL Back to PBIL home page