(data stored in ACNUC7421 zone)

EMBL: CP001349.PE140

CP001349.PE140       Location/Qualifiers
FT   CDS             complement(160252..161034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0146"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   met:M446_4614 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55192"
FT                   /db_xref="GOA:B8IUE7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE7"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACL55192.1"
FT                   /translation="MDETAPLLTRRDHDSIATLTLNRPRARNALSAALLTVLREEFARL
FT                   AEDTTIRVVVLAAEGPAFCAGHDLKEMTSYRTEPDRGAARFAALFDLCSQVMMAIPALP
FT                   QPVIAAVEGVATAAGCQLVASCDLAVAGEEARFATPGVQIGLFCSTPMVALSRNLSRKA
FT                   AMAMLLTAEMVEAAEAKDLGLVNRVVPAGTALAEAQALAAGIAARSSYTVRVGKRAFYE
FT                   QVEMPLAEAYAHAGRVMTENMLARAAEEGIAAFLNRKG"
     MDETAPLLTR RDHDSIATLT LNRPRARNAL SAALLTVLRE EFARLAEDTT IRVVVLAAEG        60
     PAFCAGHDLK EMTSYRTEPD RGAARFAALF DLCSQVMMAI PALPQPVIAA VEGVATAAGC       120
     QLVASCDLAV AGEEARFATP GVQIGLFCST PMVALSRNLS RKAAMAMLLT AEMVEAAEAK       180
     DLGLVNRVVP AGTALAEAQA LAAGIAARSS YTVRVGKRAF YEQVEMPLAE AYAHAGRVMT       240
     ENMLARAAEE GIAAFLNRKG                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page