(data stored in ACNUC7421 zone)

EMBL: CP001349.PE142

CP001349.PE142       Location/Qualifiers
FT   CDS             161760..162221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0148"
FT                   /product="ribosomal protein L13"
FT                   /note="PFAM: ribosomal protein L13; KEGG: met:M446_4612
FT                   ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55194"
FT                   /db_xref="GOA:B8IUE9"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IUE9"
FT                   /inference="protein motif:PFAM:PF00572"
FT                   /protein_id="ACL55194.1"
FT                   /translation="MKTFSLKPADVEKKWVIIDAEGLVVGRLASIVAMRLRGKHKPQYT
FT                   PHVDCGDNVIVINADKVKFTGRKYDQKVYYHHTGYPGGIKERSAKFILEGRFPERVVEK
FT                   AVERMLPRGPLFRKILGNLRVYKGSEHPHAAQQPETLDVAALNRKNVSA"
     MKTFSLKPAD VEKKWVIIDA EGLVVGRLAS IVAMRLRGKH KPQYTPHVDC GDNVIVINAD        60
     KVKFTGRKYD QKVYYHHTGY PGGIKERSAK FILEGRFPER VVEKAVERML PRGPLFRKIL       120
     GNLRVYKGSE HPHAAQQPET LDVAALNRKN VSA                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page