(data stored in ACNUC7421 zone)

EMBL: CP001349.PE143

CP001349.PE143       Location/Qualifiers
FT   CDS             162223..162711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0149"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: met:M446_4611
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55195"
FT                   /db_xref="GOA:B8IUF0"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IUF0"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ACL55195.1"
FT                   /translation="MATLQSLADLGQANKAALATADTEAPVHVQKLDAQGRAYATGKRK
FT                   DAVARVWIKPGAGTITVNDRPVDTYFARPVLRMILQQPLHVANRVDQYDIVVTVTGGGL
FT                   SGQAGAVRHGLARALTYYEPELRSPLKREGFLTRDPRVVERKKYGRKKARRSFQFSKR"
     MATLQSLADL GQANKAALAT ADTEAPVHVQ KLDAQGRAYA TGKRKDAVAR VWIKPGAGTI        60
     TVNDRPVDTY FARPVLRMIL QQPLHVANRV DQYDIVVTVT GGGLSGQAGA VRHGLARALT       120
     YYEPELRSPL KREGFLTRDP RVVERKKYGR KKARRSFQFS KR                          162
//

If you have problems or comments...

PBIL Back to PBIL home page