(data stored in ACNUC7421 zone)

EMBL: CP001349.PE144

CP001349.PE144       Location/Qualifiers
FT   CDS             162897..163703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0150"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap; KEGG:
FT                   met:M446_4609 peptidase S1 and S6 chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55196"
FT                   /db_xref="GOA:B8IUF1"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF1"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ACL55196.1"
FT                   /translation="MGRMTCIVAAAARRLAVARSLLIAGGLAASLPAQAIEGGVPASAR
FT                   DALARATVALGTLNQSGDNIQITRCSGVLIRRDLVLTAAHCVGESPLGAVVVFYRGSKP
FT                   VGPAYRAAAVSRFAVARDGAEAGDLGINLTALSLDIAVLRLAAPVRDRAPLPVGRAVRR
FT                   LPGHLLIAGVGLSGGAPGTLKTARLTPLAVTESGLTFARAEGALVCLGDSGGPVVTGGG
FT                   GGVRLWGVASAVITSTPPCGSLVVIAPAGRRLSAERGPVRAALLRR"
     MGRMTCIVAA AARRLAVARS LLIAGGLAAS LPAQAIEGGV PASARDALAR ATVALGTLNQ        60
     SGDNIQITRC SGVLIRRDLV LTAAHCVGES PLGAVVVFYR GSKPVGPAYR AAAVSRFAVA       120
     RDGAEAGDLG INLTALSLDI AVLRLAAPVR DRAPLPVGRA VRRLPGHLLI AGVGLSGGAP       180
     GTLKTARLTP LAVTESGLTF ARAEGALVCL GDSGGPVVTG GGGGVRLWGV ASAVITSTPP       240
     CGSLVVIAPA GRRLSAERGP VRAALLRR                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page