(data stored in ACNUC7421 zone)

EMBL: CP001349.PE145

CP001349.PE145       Location/Qualifiers
FT   CDS             complement(163794..164342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0151"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: met:M446_4608 YbaK/prolyl-tRNA synthetase associated
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55197"
FT                   /db_xref="GOA:B8IUF2"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="InterPro:IPR040285"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF2"
FT                   /inference="protein motif:PFAM:PF04073"
FT                   /protein_id="ACL55197.1"
FT                   /translation="MSPVTPEDLLAYLADLGIPVRTVAHRPVHTVAESRDLKAGLPGGH
FT                   SKNLFLKDRRGQLFLVVAEAEARIDLKRLHGAIGASGRLSFGSAEQLHAVLGVRPGSVT
FT                   PFGLLNDRDGLVSVILDAALMAHDPVNFHPLHNAATTAIAPGDLIRFLQATGHAPRVMT
FT                   LPEPQPEPEEGRAEISVHS"
     MSPVTPEDLL AYLADLGIPV RTVAHRPVHT VAESRDLKAG LPGGHSKNLF LKDRRGQLFL        60
     VVAEAEARID LKRLHGAIGA SGRLSFGSAE QLHAVLGVRP GSVTPFGLLN DRDGLVSVIL       120
     DAALMAHDPV NFHPLHNAAT TAIAPGDLIR FLQATGHAPR VMTLPEPQPE PEEGRAEISV       180
     HS                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page