(data stored in ACNUC7421 zone)

EMBL: CP001349.PE146

CP001349.PE146       Location/Qualifiers
FT   CDS             complement(164339..165295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0152"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: met:M446_4607
FT                   pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55198"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF3"
FT                   /inference="protein motif:PFAM:PF00291"
FT                   /protein_id="ACL55198.1"
FT                   /translation="MTITYADVEAAARRLAGVAHRTPVLTSRTADARTGAKLYFKAEPL
FT                   QRAGAFKFRGAYNAIAALGEAERRRGVLAFSSGNHAQAIAYAGALQGAPTVIVMPHDAP
FT                   AIKVAATEGYGAEVVRYDRYTEDREAVSRRLAEERGLTVIPPYDHPDVIAGQGTAVKEL
FT                   IEETGPLDVILVCLGGGGLLAGSLLSARALAPEAAIYGVEPEAGNDGQMSLARGEIVRI
FT                   PVPVSIADGALTTHLGQHTFPIIRREVTGIVTVSDAQLVAAMRFFVERMKLVVEPTGCL
FT                   AAAAAFEGIVPVAGKRVGVILSGGNVDPAALARFLAA"
     MTITYADVEA AARRLAGVAH RTPVLTSRTA DARTGAKLYF KAEPLQRAGA FKFRGAYNAI        60
     AALGEAERRR GVLAFSSGNH AQAIAYAGAL QGAPTVIVMP HDAPAIKVAA TEGYGAEVVR       120
     YDRYTEDREA VSRRLAEERG LTVIPPYDHP DVIAGQGTAV KELIEETGPL DVILVCLGGG       180
     GLLAGSLLSA RALAPEAAIY GVEPEAGNDG QMSLARGEIV RIPVPVSIAD GALTTHLGQH       240
     TFPIIRREVT GIVTVSDAQL VAAMRFFVER MKLVVEPTGC LAAAAAFEGI VPVAGKRVGV       300
     ILSGGNVDPA ALARFLAA                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page