(data stored in ACNUC7421 zone)

EMBL: CP001349.PE147

CP001349.PE147       Location/Qualifiers
FT   CDS             complement(165295..166068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0153"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   met:M446_4606 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55199"
FT                   /db_xref="GOA:B8IUF4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF4"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACL55199.1"
FT                   /translation="MEYENIRVETRGRVALITLHRPAQLNALCGPLIAELNAALDGFER
FT                   DEGIGCIILTGSEKAFAAGADIPEMRDRTHPEFFVADPFGEWDRVGRRRKPMIAAVAGY
FT                   ALGGGCELAMMCDFILAADTAKFGQPEIKLGVIPGAGGTQRLTRAVGKAKAMELCLTGR
FT                   LMAAAEAERAGLVARIVPAADLLAEAWQTAETIASMSLPAVMVAKDCVDRAFETTLAEG
FT                   VRYERGLFYGLFATADQKEGMAAFLEKRKPNFEHR"
     MEYENIRVET RGRVALITLH RPAQLNALCG PLIAELNAAL DGFERDEGIG CIILTGSEKA        60
     FAAGADIPEM RDRTHPEFFV ADPFGEWDRV GRRRKPMIAA VAGYALGGGC ELAMMCDFIL       120
     AADTAKFGQP EIKLGVIPGA GGTQRLTRAV GKAKAMELCL TGRLMAAAEA ERAGLVARIV       180
     PAADLLAEAW QTAETIASMS LPAVMVAKDC VDRAFETTLA EGVRYERGLF YGLFATADQK       240
     EGMAAFLEKR KPNFEHR                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page