(data stored in ACNUC7421 zone)

EMBL: CP001349.PE148

CP001349.PE148       Location/Qualifiers
FT   CDS             complement(166481..167230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0154"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   met:M446_4605 phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55200"
FT                   /db_xref="GOA:B8IUF5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF5"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ACL55200.1"
FT                   /translation="MSRLARLPIRSQATALWRRLRLNEVGPLASLLAVSLFGFGFFKVA
FT                   GEVAEGDTKGLDEKLLLALRRPDDLARPIGPGWLPETMRDITAFGSVFGIVYVTACVVL
FT                   YLAGTRRWRAAILVAASVGGGEILSTGLKLFFQRPRPDLVPHGMETFTASFPSGHAMLS
FT                   AVAYLTLAILLARISRGRRVKAFVLALGVVTTLLVGISRVYLGVHWPSDVLAGWCIGAA
FT                   WASLCWFVALQLQRQQVVEAPDPPPPA"
     MSRLARLPIR SQATALWRRL RLNEVGPLAS LLAVSLFGFG FFKVAGEVAE GDTKGLDEKL        60
     LLALRRPDDL ARPIGPGWLP ETMRDITAFG SVFGIVYVTA CVVLYLAGTR RWRAAILVAA       120
     SVGGGEILST GLKLFFQRPR PDLVPHGMET FTASFPSGHA MLSAVAYLTL AILLARISRG       180
     RRVKAFVLAL GVVTTLLVGI SRVYLGVHWP SDVLAGWCIG AAWASLCWFV ALQLQRQQVV       240
     EAPDPPPPA                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page