(data stored in ACNUC7421 zone)

EMBL: CP001349.PE15

CP001349.PE15        Location/Qualifiers
FT   CDS             complement(16640..18697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0016"
FT                   /product="peptidase M3A and M3B thimet/oligopeptidase F"
FT                   /EC_number="3.4.15.5"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: met:M446_0011 peptidyl-dipeptidase DCP"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55067"
FT                   /db_xref="GOA:B8IT05"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT05"
FT                   /inference="protein motif:PFAM:PF01432"
FT                   /protein_id="ACL55067.1"
FT                   /translation="MAGTTATLPGNPFSEPVWTTPHGLPPFERIEPAHYEPAFTAALAE
FT                   HEAEIAAIADSPEPPSFANTVAALERSGQGLKRVSGVFFNITGSHTNPELQAVERIMAP
FT                   RLARHRSALFLNGALWARVKALDEAGLSEEERRVLDRYRTLFRRAGADLDPAAKERVAA
FT                   ITARLAELGTRFSQNLLADESSFVLPLETEEDLGGLPPFLRAAAARAAAERGLPGHVIT
FT                   LARSLIEPFLVFSTRRDLRERAYTAWIRRGENGGETDNRAIIVETMRLRAERARLLGYE
FT                   TFADFKLADTMAGTPEAAMKLLREVWTPARERAAAERDRLQAMVREEGGNFDLAPWDWR
FT                   HYAEKLRRAEHDLDEGEIKPYLPLDGVIAASFDTASRLFGLSFEELPAFPRYHPDVRAW
FT                   AVKDRDGTTIGLFLGDYFARPSKRSGAWMSAFRSQERLIGPVTPIIVNVMNFAKGGEGE
FT                   PSLLSFDDARTLFHEFGHALHGLLSDVTYPLLAGTAVAGDFVELPSQLYEHWLEQPEVL
FT                   RAHARHYRTGEPMPEALLQRLLAARTFNQGFATVEYTASAIVDLDLHLSRAVEEGLDVN
FT                   AFEAEALRRIGMPAEISMRHRSPHFAHIFTGEGYAAGYYSYLWSEVLDADAFDAFREAG
FT                   DIFDPETARRLRTYVYGAGNLRDAQSAYTAFRGRLPSIEPLLRKRGLLAA"
     MAGTTATLPG NPFSEPVWTT PHGLPPFERI EPAHYEPAFT AALAEHEAEI AAIADSPEPP        60
     SFANTVAALE RSGQGLKRVS GVFFNITGSH TNPELQAVER IMAPRLARHR SALFLNGALW       120
     ARVKALDEAG LSEEERRVLD RYRTLFRRAG ADLDPAAKER VAAITARLAE LGTRFSQNLL       180
     ADESSFVLPL ETEEDLGGLP PFLRAAAARA AAERGLPGHV ITLARSLIEP FLVFSTRRDL       240
     RERAYTAWIR RGENGGETDN RAIIVETMRL RAERARLLGY ETFADFKLAD TMAGTPEAAM       300
     KLLREVWTPA RERAAAERDR LQAMVREEGG NFDLAPWDWR HYAEKLRRAE HDLDEGEIKP       360
     YLPLDGVIAA SFDTASRLFG LSFEELPAFP RYHPDVRAWA VKDRDGTTIG LFLGDYFARP       420
     SKRSGAWMSA FRSQERLIGP VTPIIVNVMN FAKGGEGEPS LLSFDDARTL FHEFGHALHG       480
     LLSDVTYPLL AGTAVAGDFV ELPSQLYEHW LEQPEVLRAH ARHYRTGEPM PEALLQRLLA       540
     ARTFNQGFAT VEYTASAIVD LDLHLSRAVE EGLDVNAFEA EALRRIGMPA EISMRHRSPH       600
     FAHIFTGEGY AAGYYSYLWS EVLDADAFDA FREAGDIFDP ETARRLRTYV YGAGNLRDAQ       660
     SAYTAFRGRL PSIEPLLRKR GLLAA                                             685
//

If you have problems or comments...

PBIL Back to PBIL home page