(data stored in ACNUC7421 zone)

EMBL: CP001349.PE150

CP001349.PE150       Location/Qualifiers
FT   CDS             167428..168354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4603 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55202"
FT                   /db_xref="InterPro:IPR031811"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF7"
FT                   /inference="similar to AA sequence:KEGG:M446_4603"
FT                   /protein_id="ACL55202.1"
FT                   /translation="MTHDGNAVHIGRDGWLFLVGGTNQVLRQYRATPWAAWRLWRWQRL
FT                   IERRAARAAALGLRFHQVVVPEKISIYEDRLDGVAIDPALSPARRLGQRMARSPAAGSW
FT                   IDLVGPMRAARDEGRPLYLRTDTHWTERGCQLAHAEIMRGLGAKPRPDLAERPYQDIQA
FT                   VLDLGRKLPSHPVETVRMVHYLRDARRVEANALLETFETQGRAMELHVGARAVFRNDSP
FT                   QADPRRLVLFGDSCAHFGSFFLTALLAESFREVHFLWSASLDWSYVARLRPHLLLVEMA
FT                   ERFLARLPDDRFDSEAVARQKLDRERR"
     MTHDGNAVHI GRDGWLFLVG GTNQVLRQYR ATPWAAWRLW RWQRLIERRA ARAAALGLRF        60
     HQVVVPEKIS IYEDRLDGVA IDPALSPARR LGQRMARSPA AGSWIDLVGP MRAARDEGRP       120
     LYLRTDTHWT ERGCQLAHAE IMRGLGAKPR PDLAERPYQD IQAVLDLGRK LPSHPVETVR       180
     MVHYLRDARR VEANALLETF ETQGRAMELH VGARAVFRND SPQADPRRLV LFGDSCAHFG       240
     SFFLTALLAE SFREVHFLWS ASLDWSYVAR LRPHLLLVEM AERFLARLPD DRFDSEAVAR       300
     QKLDRERR                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page