(data stored in ACNUC7421 zone)

EMBL: CP001349.PE151

CP001349.PE151       Location/Qualifiers
FT   CDS             168410..169396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0157"
FT                   /product="glutathione S-transferase domain-containing
FT                   protein"
FT                   /note="KEGG: met:M446_4602 glutathione S-transferase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55203"
FT                   /db_xref="GOA:B8IUF8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF8"
FT                   /inference="similar to AA sequence:KEGG:M446_4602"
FT                   /protein_id="ACL55203.1"
FT                   /translation="MGLLVNGVWQESWYDTRETGGRFVRKESAFRNWVTADGAPGPTGK
FT                   GGFPAEVGRYHLYVSLACPWAHRTLIVRALKGLEEAVSVAVVDPHMGAEGWVFGDTPGA
FT                   GPDTLNGARRLSEIYLKADPGYTGRVTVPVLWDKARGTIVSNESAEIIRMLNGAFGALG
FT                   ATGPDLYPADLREEIDALNAQVYDRVNNGVYKAGFATTQDAYAEAVTALFEELDRLESR
FT                   LDRGRYLFGPRLTEADIRLFTTLVRFDPVYVGHFKCNLRRIADYPNLSGYLRDLYQHPG
FT                   IARTVNLTHIKRHYYESHSTINPTGIVPLGPILDYDAPHGRAGRFAA"
     MGLLVNGVWQ ESWYDTRETG GRFVRKESAF RNWVTADGAP GPTGKGGFPA EVGRYHLYVS        60
     LACPWAHRTL IVRALKGLEE AVSVAVVDPH MGAEGWVFGD TPGAGPDTLN GARRLSEIYL       120
     KADPGYTGRV TVPVLWDKAR GTIVSNESAE IIRMLNGAFG ALGATGPDLY PADLREEIDA       180
     LNAQVYDRVN NGVYKAGFAT TQDAYAEAVT ALFEELDRLE SRLDRGRYLF GPRLTEADIR       240
     LFTTLVRFDP VYVGHFKCNL RRIADYPNLS GYLRDLYQHP GIARTVNLTH IKRHYYESHS       300
     TINPTGIVPL GPILDYDAPH GRAGRFAA                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page