(data stored in ACNUC7421 zone)

EMBL: CP001349.PE153

CP001349.PE153       Location/Qualifiers
FT   CDS             169795..171093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0159"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: met:M446_4600 cyclic
FT                   nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55205"
FT                   /db_xref="GOA:B8IUG0"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG0"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACL55205.1"
FT                   /translation="MTEPGMTEPGRTVIVGASLAGLRAAEALRHGGHRGPITLVGDEPY
FT                   LPYDRPPLSKRVLTGEERPDQITLPSRPGLDLSWRLGAAAVGLDLTAREVALATGDRIA
FT                   FDTLLIATGTRARPWPKPEEAALKGVHAIRHRDDAERLRRALAASPRRVLIIGAGFIGC
FT                   ESASACRAIGLPVTVIDPNPTPLASVLGTRIGSVVAGMLGRAGVDYRPSTRVEALEADA
FT                   EGRVRAARFVGGGAIEADIVIVALGAVRNTEWLTGSGIAADPGGVSCDGFCRVLDRAGQ
FT                   PVDGVVAAGDVARFPHPLIENGPVAFEHWGHAVAQAAHAARTLLGRHDRPYAELPAFWS
FT                   TQFDVNIKSVGLTNGADSVAVTQGSLAERRFVAVYGRAGRTVAAISFDSTRWLPAYAAR
FT                   IEARDAFPPILGATDQGRVAPADPGFPSRPARA"
     MTEPGMTEPG RTVIVGASLA GLRAAEALRH GGHRGPITLV GDEPYLPYDR PPLSKRVLTG        60
     EERPDQITLP SRPGLDLSWR LGAAAVGLDL TAREVALATG DRIAFDTLLI ATGTRARPWP       120
     KPEEAALKGV HAIRHRDDAE RLRRALAASP RRVLIIGAGF IGCESASACR AIGLPVTVID       180
     PNPTPLASVL GTRIGSVVAG MLGRAGVDYR PSTRVEALEA DAEGRVRAAR FVGGGAIEAD       240
     IVIVALGAVR NTEWLTGSGI AADPGGVSCD GFCRVLDRAG QPVDGVVAAG DVARFPHPLI       300
     ENGPVAFEHW GHAVAQAAHA ARTLLGRHDR PYAELPAFWS TQFDVNIKSV GLTNGADSVA       360
     VTQGSLAERR FVAVYGRAGR TVAAISFDST RWLPAYAARI EARDAFPPIL GATDQGRVAP       420
     ADPGFPSRPA RA                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page