(data stored in ACNUC7421 zone)

EMBL: CP001349.PE154

CP001349.PE154       Location/Qualifiers
FT   CDS             171099..172340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0160"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: met:M446_4599
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55206"
FT                   /db_xref="GOA:B8IUG1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG1"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ACL55206.1"
FT                   /translation="MPDPNLFAAVKDPANRPNPYPLYARLRETPVALQHDGSYVVTTHA
FT                   ALRALVFDPRLSSEDLPPISHPRTGNPFKDWIVNPIKDYVRTKHRPFIFRDPPDHDVLR
FT                   RHVTRQFTPERLRTMHGRVDALVADLLDRCRDARTIDLVDHFSYPLPVMVICELLGVPH
FT                   EDEPRFHGWATQLATALEPDAREDEETKGRNIETFDVIAAYMQDLIREKRRHPQDDLLT
FT                   GLATYEDPKVGRMGDYDLIATAILLLIAGHETTVNLITNGMLTLLRFPEHLERLRADPE
FT                   IAPRLIEELLRYEPPVHFRTRKALADIRMEGVTIPQGAPIVLLFASGSRDPARFPDPDR
FT                   FDPDREDNQHFGFGGSLHFCVGAPLARMEAEAALVALAQRLRNPRLIEDPPPYRPGASL
FT                   RGPQHLRLAIEGVA"
     MPDPNLFAAV KDPANRPNPY PLYARLRETP VALQHDGSYV VTTHAALRAL VFDPRLSSED        60
     LPPISHPRTG NPFKDWIVNP IKDYVRTKHR PFIFRDPPDH DVLRRHVTRQ FTPERLRTMH       120
     GRVDALVADL LDRCRDARTI DLVDHFSYPL PVMVICELLG VPHEDEPRFH GWATQLATAL       180
     EPDAREDEET KGRNIETFDV IAAYMQDLIR EKRRHPQDDL LTGLATYEDP KVGRMGDYDL       240
     IATAILLLIA GHETTVNLIT NGMLTLLRFP EHLERLRADP EIAPRLIEEL LRYEPPVHFR       300
     TRKALADIRM EGVTIPQGAP IVLLFASGSR DPARFPDPDR FDPDREDNQH FGFGGSLHFC       360
     VGAPLARMEA EAALVALAQR LRNPRLIEDP PPYRPGASLR GPQHLRLAIE GVA              413
//

If you have problems or comments...

PBIL Back to PBIL home page