(data stored in ACNUC7421 zone)

EMBL: CP001349.PE155

CP001349.PE155       Location/Qualifiers
FT   CDS             complement(172544..174295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0161"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; Patatin; KEGG:
FT                   met:M446_4598 cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55207"
FT                   /db_xref="GOA:B8IUG2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG2"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ACL55207.1"
FT                   /translation="MDIVDGATHPEIPFLAPLDLATAAAVRERLEPIAVAGGQILFEQD
FT                   APADALYALVSGAIGISARDPASGEMRPVARVRPPETVGEMALLSGEPRSATATVLRDS
FT                   YLLRLSKSAFDDLVECHPATMLYFARLLAARLRSVSSQQPLATAPMTFAVIGVTEGVEA
FT                   AGFASAFAAALPGRSTALATWPEEADETWFHALETAHDQVVYAAEAPGSGWANLCLRRA
FT                   DHVLLLAAPRHPPRGALAGRIVMPVPGWTRQDLVVLNAQGATRPGPLDPAVTALPVALR
FT                   LQARAGNAQDLARIARLAGGRARGLVLGGGGARGFAHLGVMRALAEAGLAVDLVAGTSM
FT                   GAVTGASLAMGWDLEEIVAHTVAAFVESSPLNDYTLPITALTRGAKVDRRLALHFGDAR
FT                   IEDLWLPFFCVSSNLTTGAAMVHREGPLVPALRASIAIPGLLPPVLDAEGVLVDGGVMN
FT                   NLPADLMAALGRGTVLAVDVASDLALDTMPRRSLRSRVLRRALGVPFAMPSIAQILLRA
FT                   ATVSSDASAAMARDRATAVLRPPLAGIDLRAWRSYAAVAEIGYRDARARLAEGALDAWA
FT                   AGMAAVR"
     MDIVDGATHP EIPFLAPLDL ATAAAVRERL EPIAVAGGQI LFEQDAPADA LYALVSGAIG        60
     ISARDPASGE MRPVARVRPP ETVGEMALLS GEPRSATATV LRDSYLLRLS KSAFDDLVEC       120
     HPATMLYFAR LLAARLRSVS SQQPLATAPM TFAVIGVTEG VEAAGFASAF AAALPGRSTA       180
     LATWPEEADE TWFHALETAH DQVVYAAEAP GSGWANLCLR RADHVLLLAA PRHPPRGALA       240
     GRIVMPVPGW TRQDLVVLNA QGATRPGPLD PAVTALPVAL RLQARAGNAQ DLARIARLAG       300
     GRARGLVLGG GGARGFAHLG VMRALAEAGL AVDLVAGTSM GAVTGASLAM GWDLEEIVAH       360
     TVAAFVESSP LNDYTLPITA LTRGAKVDRR LALHFGDARI EDLWLPFFCV SSNLTTGAAM       420
     VHREGPLVPA LRASIAIPGL LPPVLDAEGV LVDGGVMNNL PADLMAALGR GTVLAVDVAS       480
     DLALDTMPRR SLRSRVLRRA LGVPFAMPSI AQILLRAATV SSDASAAMAR DRATAVLRPP       540
     LAGIDLRAWR SYAAVAEIGY RDARARLAEG ALDAWAAGMA AVR                         583
//

If you have problems or comments...

PBIL Back to PBIL home page