(data stored in ACNUC7421 zone)

EMBL: CP001349.PE156

CP001349.PE156       Location/Qualifiers
FT   CDS             complement(174342..175523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4597 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55208"
FT                   /db_xref="InterPro:IPR021445"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG3"
FT                   /inference="similar to AA sequence:KEGG:M446_4597"
FT                   /protein_id="ACL55208.1"
FT                   /translation="MAAGTMSRVGGGDGSGAGFRYAAIAPITDFQRVLDESVYRPVPDA
FT                   WWVAMTDVVESTAAIAAGRYKAVNFAGAAAIAALRNALRGRDIPFVFGGDGASLLLAPD
FT                   EVETARAALAATVAWVRAEMGLTLRAALVPVSAIREAGCDLQVARYAPSPHVAYAMMTG
FT                   GGLAFAERALKRGLYAVPPADGARPDLTGLSCRFSPARARHGMVLSVIVVGAEGADPGA
FT                   TRAVIAEVLRLVAAAPAMGRPLPEGGPPLRWPPEGLAHEVRAGGAPRGLRRIALLLRTL
FT                   AALLIFRLHVPVGRFSPDRYLCELVANADFQKYDDGLRMTLDCDAATADAIEARLRAAE
FT                   AAGLVRYGLHRQAAALTTCITPVPSESNHVHFIDGEDGGYTRAARMLKAKAAA"
     MAAGTMSRVG GGDGSGAGFR YAAIAPITDF QRVLDESVYR PVPDAWWVAM TDVVESTAAI        60
     AAGRYKAVNF AGAAAIAALR NALRGRDIPF VFGGDGASLL LAPDEVETAR AALAATVAWV       120
     RAEMGLTLRA ALVPVSAIRE AGCDLQVARY APSPHVAYAM MTGGGLAFAE RALKRGLYAV       180
     PPADGARPDL TGLSCRFSPA RARHGMVLSV IVVGAEGADP GATRAVIAEV LRLVAAAPAM       240
     GRPLPEGGPP LRWPPEGLAH EVRAGGAPRG LRRIALLLRT LAALLIFRLH VPVGRFSPDR       300
     YLCELVANAD FQKYDDGLRM TLDCDAATAD AIEARLRAAE AAGLVRYGLH RQAAALTTCI       360
     TPVPSESNHV HFIDGEDGGY TRAARMLKAK AAA                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page